UniProt ID | TVP23_YEAST | |
---|---|---|
UniProt AC | P38962 | |
Protein Name | Golgi apparatus membrane protein TVP23 | |
Gene Name | TVP23 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 199 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . |
|
Protein Description | Golgi membrane protein involved in vesicular trafficking.. | |
Protein Sequence | MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITVVLLLSFDFYLTKNITGRKLVQLRWWYDSTDVNKDSNFTFESYKQYAPGPPINAIDSKLFWWSMYVTPVIWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFALPSVPGFENLSRLANIQSFFQRQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MDQARNFYNTILKSS CHHHHHHHHHHHHCC | 18.23 | 29650682 | |
63 | N-linked_Glycosylation | FDFYLTKNITGRKLV CCEEECCCCCCCEEE | 31.64 | - | |
86 | N-linked_Glycosylation | TDVNKDSNFTFESYK CCCCCCCCCCHHHHH | 50.54 | - | |
185 | N-linked_Glycosylation | PSVPGFENLSRLANI CCCCCCCHHHHHHHH | 40.84 | - | |
194 | Phosphorylation | SRLANIQSFFQRQ-- HHHHHHHHHHHCC-- | 25.00 | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TVP23_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TVP23_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TVP23_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...