| UniProt ID | MAS5_YEAST | |
|---|---|---|
| UniProt AC | P25491 | |
| Protein Name | Mitochondrial protein import protein MAS5 | |
| Gene Name | YDJ1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 409 | |
| Subcellular Localization | Cytoplasm. Cytoplasm, perinuclear region. Concentrated in a perinuclear ring as well as in the cytoplasm. | |
| Protein Description | Probably involved in mitochondrial protein import. Is also required for efficient translocation of pre-pro-alpha-factor. Involved in heme regulation of HAP1, as a component of the high-molecular-weight (HMC) complex.. | |
| Protein Sequence | MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCASQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Acetylation | --MVKETKFYDILGV --CCCCCCCEECCCC | 42.91 | 24489116 | |
| 23 | Ubiquitination | TATDVEIKKAYRKCA CCCHHHHHHHHHHHH | 20.18 | 23749301 | |
| 23 | Acetylation | TATDVEIKKAYRKCA CCCHHHHHHHHHHHH | 20.18 | 24489116 | |
| 32 | Ubiquitination | AYRKCALKYHPDKNP HHHHHHHHCCCCCCC | 24.00 | 22817900 | |
| 32 | Acetylation | AYRKCALKYHPDKNP HHHHHHHHCCCCCCC | 24.00 | 25381059 | |
| 33 | Phosphorylation | YRKCALKYHPDKNPS HHHHHHHCCCCCCCC | 21.31 | 28889911 | |
| 37 | Ubiquitination | ALKYHPDKNPSEEAA HHHCCCCCCCCHHHH | 75.18 | 23749301 | |
| 37 | Acetylation | ALKYHPDKNPSEEAA HHHCCCCCCCCHHHH | 75.18 | 24489116 | |
| 46 | Ubiquitination | PSEEAAEKFKEASAA CCHHHHHHHHHHHHH | 57.94 | 17644757 | |
| 46 | Acetylation | PSEEAAEKFKEASAA CCHHHHHHHHHHHHH | 57.94 | 24489116 | |
| 48 | Ubiquitination | EEAAEKFKEASAAYE HHHHHHHHHHHHHHH | 64.54 | 17644757 | |
| 48 | Acetylation | EEAAEKFKEASAAYE HHHHHHHHHHHHHHH | 64.54 | 24489116 | |
| 62 | Acetylation | EILSDPEKRDIYDQF HHCCCHHHCCHHHHH | 61.84 | 24489116 | |
| 62 | Ubiquitination | EILSDPEKRDIYDQF HHCCCHHHCCHHHHH | 61.84 | 17644757 | |
| 114 | Acetylation | PRGPQRGKDIKHEIS CCCCCCCCCHHHHHH | 59.47 | 24489116 | |
| 114 | Ubiquitination | PRGPQRGKDIKHEIS CCCCCCCCCHHHHHH | 59.47 | 22817900 | |
| 117 | Ubiquitination | PQRGKDIKHEISASL CCCCCCHHHHHHHCH | 45.37 | 24961812 | |
| 117 | Acetylation | PQRGKDIKHEISASL CCCCCCHHHHHHHCH | 45.37 | 24489116 | |
| 129 | Acetylation | ASLEELYKGRTAKLA HCHHHHHCCHHHHHH | 55.32 | 24489116 | |
| 129 | Ubiquitination | ASLEELYKGRTAKLA HCHHHHHCCHHHHHH | 55.32 | 22817900 | |
| 134 | Ubiquitination | LYKGRTAKLALNKQI HHCCHHHHHHHCCCE | 33.41 | 23749301 | |
| 139 | Ubiquitination | TAKLALNKQILCKEC HHHHHHCCCEECHHC | 39.30 | 23749301 | |
| 144 | Ubiquitination | LNKQILCKECEGRGG HCCCEECHHCCCCCC | 63.05 | 23749301 | |
| 152 | Acetylation | ECEGRGGKKGAVKKC HCCCCCCCCCCEEEC | 51.35 | 25381059 | |
| 152 | Ubiquitination | ECEGRGGKKGAVKKC HCCCCCCCCCCEEEC | 51.35 | 22817900 | |
| 153 | Acetylation | CEGRGGKKGAVKKCT CCCCCCCCCCEEECC | 56.21 | 25381059 | |
| 153 | Ubiquitination | CEGRGGKKGAVKKCT CCCCCCCCCCEEECC | 56.21 | 22817900 | |
| 157 | Ubiquitination | GGKKGAVKKCTSCNG CCCCCCEEECCCCCC | 41.41 | 22817900 | |
| 158 | Ubiquitination | GKKGAVKKCTSCNGQ CCCCCEEECCCCCCC | 35.83 | 23749301 | |
| 183 | Phosphorylation | PMIQRFQTECDVCHG HHHHHHHCCCCCCCC | 35.55 | 23749301 | |
| 198 | Ubiquitination | TGDIIDPKDRCKSCN CCCCCCHHHHHHHCC | 54.80 | 23749301 | |
| 198 | Acetylation | TGDIIDPKDRCKSCN CCCCCCHHHHHHHCC | 54.80 | 24489116 | |
| 202 | Ubiquitination | IDPKDRCKSCNGKKV CCHHHHHHHCCCCCC | 59.96 | 22817900 | |
| 214 | Ubiquitination | KKVENERKILEVHVE CCCCCCCEEEEEEEC | 45.52 | 15699485 | |
| 225 | Acetylation | VHVEPGMKDGQRIVF EEECCCCCCCCEEEE | 65.70 | 24489116 | |
| 225 | Succinylation | VHVEPGMKDGQRIVF EEECCCCCCCCEEEE | 65.70 | 23954790 | |
| 225 | Ubiquitination | VHVEPGMKDGQRIVF EEECCCCCCCCEEEE | 65.70 | 15699485 | |
| 233 | Ubiquitination | DGQRIVFKGEADQAP CCCEEEEECCHHCCC | 44.97 | 17644757 | |
| 257 | Ubiquitination | IVSERPHKSFKRDGD EEECCCCCCCCCCCC | 61.34 | 17644757 | |
| 294 | Ubiquitination | HVSGDWLKVGIVPGE ECCCCCEEEEEECCC | 33.87 | 17644757 | |
| 309 | Ubiquitination | VIAPGMRKVIEGKGM EECCCCCHHHCCCCC | 38.38 | 17644757 | |
| 314 | Ubiquitination | MRKVIEGKGMPIPKY CCHHHCCCCCCCCCC | 38.97 | 23749301 | |
| 320 | Ubiquitination | GKGMPIPKYGGYGNL CCCCCCCCCCCCCCE | 58.19 | 24961812 | |
| 320 | Acetylation | GKGMPIPKYGGYGNL CCCCCCCCCCCCCCE | 58.19 | 24489116 | |
| 321 | Phosphorylation | KGMPIPKYGGYGNLI CCCCCCCCCCCCCEE | 15.49 | 21440633 | |
| 324 | Phosphorylation | PIPKYGGYGNLIIKF CCCCCCCCCCEEEEE | 9.85 | 22369663 | |
| 330 | Ubiquitination | GYGNLIIKFTIKFPE CCCCEEEEEEEECCC | 29.48 | 17644757 | |
| 334 | Acetylation | LIIKFTIKFPENHFT EEEEEEEECCCCCCC | 52.38 | 24489116 | |
| 341 | Phosphorylation | KFPENHFTSEENLKK ECCCCCCCCHHHHHH | 27.90 | 21440633 | |
| 342 | Phosphorylation | FPENHFTSEENLKKL CCCCCCCCHHHHHHH | 41.80 | 27214570 | |
| 347 | Ubiquitination | FTSEENLKKLEEILP CCCHHHHHHHHHHCC | 67.88 | 17644757 | |
| 348 | Ubiquitination | TSEENLKKLEEILPP CCHHHHHHHHHHCCC | 65.38 | 23749301 | |
| 363 | Ubiquitination | RIVPAIPKKATVDEC CCCCCCCCCCCCCEE | 49.26 | 23749301 | |
| 364 | Ubiquitination | IVPAIPKKATVDECV CCCCCCCCCCCCEEE | 43.89 | 23749301 | |
| 392 | Phosphorylation | ASRGGANYDSDEEEQ CCCCCCCCCCCCHHC | 19.11 | 23607784 | |
| 394 | Phosphorylation | RGGANYDSDEEEQGG CCCCCCCCCCHHCCC | 36.24 | 21440633 | |
| 406 | Methylation | QGGEGVQCASQ---- CCCCCCCCCCC---- | 3.50 | - | |
| 406 | Farnesylation | QGGEGVQCASQ---- CCCCCCCCCCC---- | 3.50 | 1527016 | |
| 406 | Farnesylation | QGGEGVQCASQ---- CCCCCCCCCCC---- | 3.50 | 1527016 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MAS5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAS5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAS5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-183 AND SER-342, ANDMASS SPECTROMETRY. | |
| Prenylation | |
| Reference | PubMed |
| "Farnesylation of YDJ1p is required for function at elevated growthtemperatures in Saccharomyces cerevisiae."; Caplan A.J., Tsai J., Casey P.J., Douglas M.G.; J. Biol. Chem. 267:18890-18895(1992). Cited for: ISOPRENYLATION AT CYS-406. | |
