UniProt ID | YIH7_YEAST | |
---|---|---|
UniProt AC | P40508 | |
Protein Name | Uncharacterized protein YIL077C | |
Gene Name | YIL077C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 320 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLGKEEEQQYGQNGKGMENELPFMKRPWFKKAYENAIEFHEKDELLDARDRLELSKAYRSIAKAEMWGGWLGFSAVFLTPFAYRYYKTKAIKGVKVPRNFVLGVMALFFATNFAGRSMYTRQLNERDPTGVLKDNYSNKYGDNDFGAFQHDQTKEIPRNQRQYNMMRLLDSGSPSRWSMYFYITYQNPERRLPDPKVKLQQMKKGGVFNGSPFMNQRDPIGLYRNKGRKSPDPIEGEQNDSPVLSSWEKIRNGDNSSSSSWENIRNTSRDQSQESDASVDHESDIFISGFSDDGNATDNSSSDDKYQRLLQSGRYGGNRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YIH7_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIH7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIH7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIH7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSB1_YEAST | SSB1 | physical | 22940862 | |
CLP1_YEAST | CLP1 | genetic | 27708008 | |
PRP6_YEAST | PRP6 | genetic | 27708008 | |
TAF5_YEAST | TAF5 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
NU145_YEAST | NUP145 | genetic | 27708008 | |
TEL2_YEAST | TEL2 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
NUF2_YEAST | NUF2 | genetic | 27708008 | |
MGR1_YEAST | MGR1 | genetic | 27708008 | |
SNT1_YEAST | SNT1 | genetic | 27708008 | |
ERG3_YEAST | ERG3 | genetic | 27708008 | |
ENV10_YEAST | ENV10 | genetic | 27708008 | |
ERG6_YEAST | ERG6 | genetic | 27708008 | |
MGR3_YEAST | MGR3 | genetic | 27708008 | |
MKS1_YEAST | MKS1 | genetic | 27708008 | |
EOS1_YEAST | EOS1 | genetic | 27708008 | |
RTG1_YEAST | RTG1 | genetic | 27708008 | |
NAA30_YEAST | MAK3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...