UniProt ID | NAA30_YEAST | |
---|---|---|
UniProt AC | Q03503 | |
Protein Name | N-alpha-acetyltransferase 30 | |
Gene Name | MAK3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 176 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Catalytic component of the NatC N-terminal acetyltransferase, which catalyzes acetylation of the N-terminus Met of L-A virus GAG protein and possibly GRH1.. | |
Protein Sequence | MEIVYKPLDIRNEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNIPIGCIVCKMDPHRNVRLRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETEVENSAALNLYEGMGFIRMKRMFRYYLNEGDAFKLILPLTEKSCTRSTFLMHGRLAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Ubiquitination | EQFASIKKLIDADLS HHHHHHHHHHCCCCC | 49.34 | 23749301 | |
80 | Phosphorylation | RNVRLRGYIGMLAVE CCEEECCEEEEEEEE | 6.46 | 22369663 | |
88 | Phosphorylation | IGMLAVESTYRGHGI EEEEEEEECCCCCCH | 24.92 | 22369663 | |
89 | Phosphorylation | GMLAVESTYRGHGIA EEEEEEECCCCCCHH | 12.06 | 22369663 | |
90 | Phosphorylation | MLAVESTYRGHGIAK EEEEEECCCCCCHHH | 24.71 | 22369663 | |
153 | Ubiquitination | LNEGDAFKLILPLTE CCCCCCEEEEEEECC | 36.02 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAA30_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAA30_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAA30_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...