| UniProt ID | ADY4_YEAST | |
|---|---|---|
| UniProt AC | Q05955 | |
| Protein Name | Accumulates dyads protein 4 | |
| Gene Name | ADY4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 493 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body . Localizes to the meiotic outer plaque of the SPB, at the end of the meiotic spindles. | |
| Protein Description | Involved in the pathway that organizes the shaping and sizing of the prospore membrane (PSM) during sporulation. May be required to stabilize the outer plaque of the spindle pole body (SPB).. | |
| Protein Sequence | MNKDVDYQTFKKSLRKEFKKAVKTILNLQAYNGDLIRDFLALYIPYHVVFYNLSIMKKGSPLRIQTNNLLKEALAKILNFNLAMGPKHIIKIMKKDKADPETMNKLKLVLYIKLFQGVFGHVDKNYNLAFQSFRWCLQFIAYSKRTRLFASIADEQIGAFYELCELFISMLCCHCFLIDLKENEALVGNNLKNFIKRQNPNYSHGFDLNEETKSLQWHWSLDEVDVIEALYCVAFDAMDKITLKFSKVNENFVFSQFFQYCAEIEEMLAILRGKIWECECDVFGPRIGLLVDSNHMNETIQKNILSITFKLKNDPQIICCLNKILEGLLLSSGVQFKVIQFFYVLKLYYMQDNEYTFEASSEMDKLTIECLCIIENIIDACDNPDEVTDYQLPKVLLTAMEGKLLVAEKISEDNDCSESLDDYHPRTYQFRHPRIIIDKMKTKLKQKLRFDSPKDPETDDHWIEYWKYCYQDNIGNLPDILSRIYQTFTDPSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 419 | Phosphorylation | EDNDCSESLDDYHPR CCCCCCCCCCCCCCC | 22.32 | 27214570 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADY4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADY4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADY4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
