| UniProt ID | AIM32_YEAST | |
|---|---|---|
| UniProt AC | Q04689 | |
| Protein Name | Altered inheritance of mitochondria protein 32 | |
| Gene Name | AIM32 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 311 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MLRITVKTLQQRASFHHSFKHISVPDLHTRAQNDQTNCYCQEINARLPSKTDPLDPHIKLPHRTPNYNKHVLLLSPGDRFAQPWKVAWNHNLDTNTNRPYNAISKLRSHLGGSPGILINAVHLQNEFIPRPKQHDEWLYFFVIPDMKLYVIKETDIEEFASFLDEGAIQAPKLSFQDYLSGKAKASQQVHEVHHRKLTRFQGETFLRDWNLVCGHYKRDAKCGEMGPDIIAAFQDEKLFPENNLALISHIGGHIFAGNVIFYKLFGREKMQNKLDSLWFGKVYPHNLKLLCENLENGKIIDEMYRGGISMN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AIM32_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIM32_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIM32_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIM32_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ADY4_YEAST | ADY4 | genetic | 27708008 | |
| VPS8_YEAST | VPS8 | genetic | 27708008 | |
| CCZ1_YEAST | CCZ1 | genetic | 27708008 | |
| AGP1_YEAST | AGP1 | genetic | 27708008 | |
| RPA14_YEAST | RPA14 | genetic | 27708008 | |
| PALF_YEAST | RIM8 | genetic | 27708008 | |
| HUR1_YEAST | HUR1 | genetic | 27708008 | |
| SODM_YEAST | SOD2 | genetic | 27708008 | |
| RL17B_YEAST | RPL17B | genetic | 27708008 | |
| YJY1_YEAST | YJR011C | genetic | 27708008 | |
| VPS68_YEAST | VPS68 | genetic | 27708008 | |
| SNU66_YEAST | SNU66 | genetic | 27708008 | |
| POC4_YEAST | POC4 | genetic | 27708008 | |
| PET20_YEAST | PET20 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...