UniProt ID | AIM32_YEAST | |
---|---|---|
UniProt AC | Q04689 | |
Protein Name | Altered inheritance of mitochondria protein 32 | |
Gene Name | AIM32 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 311 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLRITVKTLQQRASFHHSFKHISVPDLHTRAQNDQTNCYCQEINARLPSKTDPLDPHIKLPHRTPNYNKHVLLLSPGDRFAQPWKVAWNHNLDTNTNRPYNAISKLRSHLGGSPGILINAVHLQNEFIPRPKQHDEWLYFFVIPDMKLYVIKETDIEEFASFLDEGAIQAPKLSFQDYLSGKAKASQQVHEVHHRKLTRFQGETFLRDWNLVCGHYKRDAKCGEMGPDIIAAFQDEKLFPENNLALISHIGGHIFAGNVIFYKLFGREKMQNKLDSLWFGKVYPHNLKLLCENLENGKIIDEMYRGGISMN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of AIM32_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AIM32_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AIM32_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AIM32_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADY4_YEAST | ADY4 | genetic | 27708008 | |
VPS8_YEAST | VPS8 | genetic | 27708008 | |
CCZ1_YEAST | CCZ1 | genetic | 27708008 | |
AGP1_YEAST | AGP1 | genetic | 27708008 | |
RPA14_YEAST | RPA14 | genetic | 27708008 | |
PALF_YEAST | RIM8 | genetic | 27708008 | |
HUR1_YEAST | HUR1 | genetic | 27708008 | |
SODM_YEAST | SOD2 | genetic | 27708008 | |
RL17B_YEAST | RPL17B | genetic | 27708008 | |
YJY1_YEAST | YJR011C | genetic | 27708008 | |
VPS68_YEAST | VPS68 | genetic | 27708008 | |
SNU66_YEAST | SNU66 | genetic | 27708008 | |
POC4_YEAST | POC4 | genetic | 27708008 | |
PET20_YEAST | PET20 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...