UniProt ID | PET20_YEAST | |
---|---|---|
UniProt AC | Q99373 | |
Protein Name | Protein PET20, mitochondrial | |
Gene Name | PET20 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 253 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Required for respiratory growth, stability of the mitochondrial genome and for proper assembly or maintenance of mitochondrial proteins.. | |
Protein Sequence | MLKLARPFIPPLSRNNAISSGIVLTSRRFQSSFTFLSNQSLLSKNQMKSKRKKGSKKAAYHRQPPEHEHTAPLIKQNKTITKKEHSDVRGSHLKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRPLFINPNDPKLKEDTGSTLYEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPFHPPKEKSMNTNELIHVSAKRNTLVDNKTSETLQRKMDEFSKRRGKGRKKSVVTLLQMKKKLEG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
101 | Phosphorylation | KKKRSDFSWLPRVPS CCCCCCCCCCCCCCC | 32.47 | 30377154 | |
108 | Phosphorylation | SWLPRVPSTSHLKQS CCCCCCCCCCCCCCC | 39.42 | 23749301 | |
110 | Phosphorylation | LPRVPSTSHLKQSDM CCCCCCCCCCCCCCC | 31.03 | 30377154 | |
240 | Phosphorylation | RGKGRKKSVVTLLQM CCCCHHHHHHHHHHH | 25.51 | 24961812 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PET20_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PET20_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PET20_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...