dbPTM

MPC1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MPC1_YEAST
UniProt AC	P53157
Protein Name	Mitochondrial pyruvate carrier 1 {ECO:0000303\|PubMed:22628554, ECO:0000303\|PubMed:22628558}
Gene Name	MPC1 {ECO:0000303\|PubMed:22628554, ECO:0000303\|PubMed:22628558}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	130
Subcellular Localization	Mitochondrion . Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Mediates the uptake of pyruvate into mitochondria..
Protein Sequence	MSQPVQRAAARSFLQKYINKETLKYIFTTHFWGPVSNFGIPIAAIYDLKKDPTLISGPMTFALVTYSGVFMKYALSVSPKNYLLFGCHLINETAQLAQGYRFLKYTYFTTDEEKKALDKEWKEKEKTGKQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
16	Acetylation	AARSFLQKYINKETL HHHHHHHHHCCHHHH	50.69	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MPC1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MPC1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MPC1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPC2_YEAST	MPC2	physical	22628558
MPC3_YEAST	MPC3	physical	22628558
GPDM_YEAST	GUT2	physical	22628558
MGR3_YEAST	MGR3	physical	22628558
MPM1_YEAST	MPM1	physical	22628558
MAOM_YEAST	MAE1	genetic	22628558
CRC1_YEAST	CRC1	genetic	24244496
MPC1_YEAST	MPC1	physical	24244496
SLX5_YEAST	SLX5	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
NEW1_YEAST	NEW1	genetic	27708008
CDC24_YEAST	CDC24	genetic	27708008
CDC27_YEAST	CDC27	genetic	27708008
SEC18_YEAST	SEC18	genetic	27708008
CDC1_YEAST	CDC1	genetic	27708008
RMRP_YEAST	SNM1	genetic	27708008
MPPA_YEAST	MAS2	genetic	27708008
EXO70_YEAST	EXO70	genetic	27708008
DPOD2_YEAST	POL31	genetic	27708008
SEC13_YEAST	SEC13	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
SEC39_YEAST	SEC39	genetic	27708008
ORC1_YEAST	ORC1	genetic	27708008
LIP1_YEAST	LIP1	genetic	27708008
LST8_YEAST	LST8	genetic	27708008
SEC12_YEAST	SEC12	genetic	27708008
SGT1_YEAST	SGT1	genetic	27708008
PROF_YEAST	PFY1	genetic	27708008
TBF1_YEAST	TBF1	genetic	27708008
HRR25_YEAST	HRR25	genetic	27708008
SNF5_YEAST	SNF5	genetic	27708008
BUD31_YEAST	BUD31	genetic	27708008
BTN2_YEAST	BTN2	genetic	27708008
LRP1_YEAST	LRP1	genetic	27708008
GVP36_YEAST	GVP36	genetic	27708008
MOG1_YEAST	MOG1	genetic	27708008
MAOM_YEAST	MAE1	genetic	27708008
ALAM_YEAST	ALT1	genetic	27708008
ELO3_YEAST	ELO3	genetic	27708008
VIP1_YEAST	VIP1	genetic	27708008
GBLP_YEAST	ASC1	genetic	27708008
YNB0_YEAST	YNL010W	genetic	27708008
IPB2_YEAST	PBI2	genetic	27708008
RAS2_YEAST	RAS2	genetic	27708008
FAR11_YEAST	FAR11	genetic	27708008
BRE5_YEAST	BRE5	genetic	27708008
LGE1_YEAST	LGE1	genetic	27708008
NAA30_YEAST	MAK3	genetic	27708008
SPEE_YEAST	SPE3	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MPC1_YEAST

Related Literatures of Post-Translational Modification