dbPTM

MPC3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MPC3_YEAST
UniProt AC	P53311
Protein Name	Mitochondrial pyruvate carrier 3 {ECO:0000303\|PubMed:22628554, ECO:0000303\|PubMed:22628558}
Gene Name	MPC3 {ECO:0000303\|PubMed:22628554, ECO:0000303\|PubMed:22628558}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	146
Subcellular Localization	Mitochondrion . Mitochondrion inner membrane Multi-pass membrane protein .
Protein Description	Mediates the uptake of pyruvate into mitochondria..
Protein Sequence	MSASAFNFAFRRFWNSETGPKTVHFWAPTLKWGLVFAGLNDIKRPVEKVSGAQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHLTRIANFRIRNGDSFKQVIHYIIKGETPAAVAAKQTASTSMNKGVIGTNPPITH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
119	Phosphorylation	HYIIKGETPAAVAAK HHHHCCCCHHHHHHH	27.22	27017623
132	Phosphorylation	AKQTASTSMNKGVIG HHHCCCCCCCCCCCC	20.19	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MPC3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MPC3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MPC3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CRC1_YEAST	CRC1	genetic	24244496
MPC1_YEAST	MPC1	physical	24244496
ARP3_YEAST	ARP3	genetic	27708008
UBC13_YEAST	UBC13	genetic	27708008
SCC1_YEAST	MCD1	genetic	27708008
RPB1_YEAST	RPO21	genetic	27708008
RPN5_YEAST	RPN5	genetic	27708008
CDC1_YEAST	CDC1	genetic	27708008
SNU56_YEAST	SNU56	genetic	27708008
NSE3_YEAST	NSE3	genetic	27708008
SRPR_YEAST	SRP101	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
SAD1_YEAST	SAD1	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
KTHY_YEAST	CDC8	genetic	27708008
CWC16_YEAST	YJU2	genetic	27708008
SSL1_YEAST	SSL1	genetic	27708008
RPC6_YEAST	RPC34	genetic	27708008
MOT1_YEAST	MOT1	genetic	27708008
ORC4_YEAST	ORC4	genetic	27708008
SWD1_YEAST	SWD1	genetic	27708008
MGMT_YEAST	MGT1	genetic	27708008
BAP3_YEAST	BAP3	genetic	27708008
SAC3_YEAST	SAC3	genetic	27708008
RLA4_YEAST	RPP2B	genetic	27708008
SLX8_YEAST	SLX8	genetic	27708008
IES1_YEAST	IES1	genetic	27708008
RTF1_YEAST	RTF1	genetic	27708008
MUP1_YEAST	MUP1	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
ASF1_YEAST	ASF1	genetic	27708008
CSN12_YEAST	YJR084W	genetic	27708008
ILM1_YEAST	ILM1	genetic	27708008
ELF1_YEAST	ELF1	genetic	27708008
SAC1_YEAST	SAC1	genetic	27708008
SIC1_YEAST	SIC1	genetic	27708008
SFL1_YEAST	SFL1	genetic	27708008
RAD1_YEAST	RAD1	genetic	27708008
RU2A_YEAST	LEA1	genetic	27708008
MPC1_YEAST	MPC1	physical	25672363

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MPC3_YEAST

Related Literatures of Post-Translational Modification