| UniProt ID | ELF1_YEAST | |
|---|---|---|
| UniProt AC | P36053 | |
| Protein Name | Transcription elongation factor 1 | |
| Gene Name | ELF1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 145 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions.. | |
| Protein Sequence | MGKRKKSTRKPTKRLVQKLDTKFNCLFCNHEKSVSCTLDKKNSIGTLSCKICGQSFQTRINSLSQPVDVYSDWFDAVEEVNSGRGSDTDDGDEGSDSDYESDSEQDAKTQNDGEIDSDEEEVDSDEERIGQVKRGRGALVDSDDE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 18 | Acetylation | PTKRLVQKLDTKFNC CCHHHHHHHCHHCCE | 40.63 | 24489116 | |
| 18 | Ubiquitination | PTKRLVQKLDTKFNC CCHHHHHHHCHHCCE | 40.63 | 22817900 | |
| 22 | Ubiquitination | LVQKLDTKFNCLFCN HHHHHCHHCCEEECC | 33.96 | 23749301 | |
| 50 | Ubiquitination | SIGTLSCKICGQSFQ CEEEEEEEECCCCHH | 37.34 | 22817900 | |
| 55 | Phosphorylation | SCKICGQSFQTRINS EEEECCCCHHHHHHH | 12.47 | 28889911 | |
| 82 | Phosphorylation | DAVEEVNSGRGSDTD HHHHHHHCCCCCCCC | 34.73 | 19795423 | |
| 109 | Phosphorylation | DSEQDAKTQNDGEID CCHHHHHHCCCCCCC | 34.03 | 22890988 | |
| 117 | Phosphorylation | QNDGEIDSDEEEVDS CCCCCCCCCHHHCCC | 53.21 | 22369663 | |
| 124 | Phosphorylation | SDEEEVDSDEERIGQ CCHHHCCCCHHHHHH | 52.69 | 22369663 | |
| 142 | Phosphorylation | GRGALVDSDDE---- CCCCCCCCCCC---- | 39.21 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELF1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELF1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELF1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-55; SER-117; SER-124 ANDSER-142, AND MASS SPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117 AND SER-124, ANDMASS SPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-117; SER-124 ANDSER-142, AND MASS SPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-142, AND MASSSPECTROMETRY. | |
