UniProt ID | HUA1_YEAST | |
---|---|---|
UniProt AC | P40325 | |
Protein Name | Proline-rich protein HUA1 | |
Gene Name | HUA1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 198 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | May be involved in assembly and disassembly of the actin cytoskeleton.. | |
Protein Sequence | MSKDTHDDELPSYEDVIKEEERLQSQPPRPPRPAANLAQGHQSRPHQRPSTMPATSSSQTYAHSHSYTPTSSQPRPPPRPQQNPSLPWTYPPRFYCSKCGNTGYKLKNGRSCKSCWRRFAPQNNVVSAPTYYTNYTMPVYTNAWQGNRPLYVQPGDPRLGGVLCGECRGSGRTRFLLDEDICPLCHGVGRIITQPQRY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSKDTHDDE ------CCCCCCCCC | 38.96 | 22814378 | |
3 | Ubiquitination | -----MSKDTHDDEL -----CCCCCCCCCC | 66.40 | 24961812 | |
18 | Ubiquitination | PSYEDVIKEEERLQS CCHHHHHHHHHHHHC | 59.94 | 12872131 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HUA1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HUA1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HUA1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Ubiquitylation | |
Reference | PubMed |
"A proteomics approach to understanding protein ubiquitination."; Peng J., Schwartz D., Elias J.E., Thoreen C.C., Cheng D.,Marsischky G., Roelofs J., Finley D., Gygi S.P.; Nat. Biotechnol. 21:921-926(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-3 AND LYS-18, AND MASSSPECTROMETRY. |