| UniProt ID | RV161_YEAST | |
|---|---|---|
| UniProt AC | P25343 | |
| Protein Name | Reduced viability upon starvation protein 161 | |
| Gene Name | RVS161 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 265 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Component of a cytoskeletal structure that is required for the formation of endocytic vesicles at the plasma membrane level.. | |
| Protein Sequence | MSWEGFKKAINRAGHSVIIKNVDKTIDKEYDMEERRYKVLQRAGEALQKEAKGFLDSLRAVTASQTTIAEVISNLYDDSKYVAGGGYNVGNYYLQCVQDFDSETVKQLDGPLRETVLDPITKFSTYFKEIEEAIKKRDHKKQDFDAAKAKVRRLVDKPAKDASKLPRAEKELSLAKDIFENLNNQLKTELPQLVSLRVPYFDPSFEALIKIQLRFCTDGYTRLAQIQQYLDQQSRDDYANGLLDTKIEELLGQMTSLDICALGIK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSWEGFKKA ------CCHHHHHHH | 33.56 | 15665377 | |
| 7 | Acetylation | -MSWEGFKKAINRAG -CCHHHHHHHHHHCC | 52.75 | 25381059 | |
| 16 | Phosphorylation | AINRAGHSVIIKNVD HHHHCCCCEEEECCC | 17.69 | 20377248 | |
| 20 | Acetylation | AGHSVIIKNVDKTID CCCCEEEECCCCCCC | 39.53 | 25381059 | |
| 24 | Acetylation | VIIKNVDKTIDKEYD EEEECCCCCCCCCCC | 43.00 | 24489116 | |
| 28 | Acetylation | NVDKTIDKEYDMEER CCCCCCCCCCCHHHH | 55.08 | 24489116 | |
| 52 | Acetylation | EALQKEAKGFLDSLR HHHHHHHHHHHHHHH | 51.81 | 24489116 | |
| 122 | Acetylation | TVLDPITKFSTYFKE HHCCHHHHHHHHHHH | 37.73 | 24489116 | |
| 128 | Acetylation | TKFSTYFKEIEEAIK HHHHHHHHHHHHHHH | 47.58 | 24489116 | |
| 141 | Ubiquitination | IKKRDHKKQDFDAAK HHHCCCCCCCHHHHH | 52.24 | 23749301 | |
| 157 | Acetylation | KVRRLVDKPAKDASK HHHHHHCCCCCCHHH | 39.12 | 25381059 | |
| 160 | Acetylation | RLVDKPAKDASKLPR HHHCCCCCCHHHCCH | 63.45 | 25381059 | |
| 164 | Acetylation | KPAKDASKLPRAEKE CCCCCHHHCCHHHHH | 65.32 | 24489116 | |
| 170 | Ubiquitination | SKLPRAEKELSLAKD HHCCHHHHHHHHHHH | 64.07 | 23749301 | |
| 170 | Acetylation | SKLPRAEKELSLAKD HHCCHHHHHHHHHHH | 64.07 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RV161_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RV161_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RV161_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16, AND MASSSPECTROMETRY. | |
