YKE44_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YKE44_YEAST
• UniProt AC: P36092
• Protein Name: Uncharacterized protein YKL044W
• Gene Name: YKL044W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 106
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MGYVIMTFSSARMSERRARIIYIWMHLSAYKINFPFVQFPTFFSLFRLQKKAAILIKNPSPFFLFFLFPYRKNSTARTIHQINQAVALVLLCVSHHLTYLPSVPSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MGYVIMTFSS -----CCEEEEEECC	5.87	28889911
7	Phosphorylation	-MGYVIMTFSSARMS -CCEEEEEECCHHHC	14.83	28889911
9	Phosphorylation	GYVIMTFSSARMSER CEEEEEECCHHHCHH	17.58	28889911
10	Phosphorylation	YVIMTFSSARMSERR EEEEEECCHHHCHHH	18.72	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YKE44_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YKE44_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YKE44_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YKE44_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.