| UniProt ID | SUR1_YEAST | |
|---|---|---|
| UniProt AC | P33300 | |
| Protein Name | Mannosyl phosphorylinositol ceramide synthase SUR1 | |
| Gene Name | SUR1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 382 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide. Suppressor of RVS161 mutation.. | |
| Protein Sequence | MRKELKYLICFNILLLLSIIYYTFDLLTLCIDDTVKDAILEEDLNPDAPPKPQLIPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRKTSPLGVSNDVMGSVPRHPFFLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWRIPKNGTVRILQPAYYKMHSYSFFSITKGSSWHLDDAKLMKALENHILSCVVTGFIFGFFILYGEFTFYCWLCSKNFSNLTKNWKLNAIKVRFVTILNSLGLRLKLSKSTSDTASATLLARQQKRLRKDSNTNIVLLKSSRKSDVYDLEKNDSSKYSLGNNSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 57 | Ubiquitination | PKPQLIPKIIHQTYK CCCCCHHHHHHHHCC | 47.50 | 17644757 | |
| 64 | Ubiquitination | KIIHQTYKTEDIPEH HHHHHHCCCCCCCHH | 49.15 | 17644757 | |
| 73 | Ubiquitination | EDIPEHWKEGRQKCL CCCCHHHHHHHHHHH | 52.80 | 17644757 | |
| 146 | Ubiquitination | LDDGCERKLDPLLAF CCCCCCCCCHHHHHH | 34.64 | 17644757 | |
| 159 | Ubiquitination | AFPAFLRKTSPLGVS HHHHHHHCCCCCCCC | 56.34 | 23749301 | |
| 192 | Phosphorylation | SLKHYDKYWFIPYMT HCCCCCCEEEECCEE | 11.58 | 19779198 | |
| 204 | Phosphorylation | YMTIMGSTGPLFLSV CEEECCCCCHHHHHH | 36.77 | 19779198 | |
| 327 | Ubiquitination | GLRLKLSKSTSDTAS CCEEEECCCCCCHHH | 69.09 | 23749301 | |
| 347 | Ubiquitination | RQQKRLRKDSNTNIV HHHHHHCCCCCCCEE | 70.83 | 23749301 | |
| 349 | Phosphorylation | QKRLRKDSNTNIVLL HHHHCCCCCCCEEEE | 48.89 | 22369663 | |
| 351 | Phosphorylation | RLRKDSNTNIVLLKS HHCCCCCCCEEEEEC | 30.21 | 22890988 | |
| 357 | Ubiquitination | NTNIVLLKSSRKSDV CCCEEEEECCCCCCC | 42.07 | 22817900 | |
| 361 | Ubiquitination | VLLKSSRKSDVYDLE EEEECCCCCCCEECC | 53.61 | 23749301 | |
| 362 | Phosphorylation | LLKSSRKSDVYDLEK EEECCCCCCCEECCC | 31.06 | 30377154 | |
| 369 | Ubiquitination | SDVYDLEKNDSSKYS CCCEECCCCCCCCCC | 73.65 | 23793018 | |
| 374 | Ubiquitination | LEKNDSSKYSLGNNS CCCCCCCCCCCCCCC | 42.69 | 23749301 | |
| 375 | Phosphorylation | EKNDSSKYSLGNNSS CCCCCCCCCCCCCCC | 15.86 | 22369663 | |
| 376 | Phosphorylation | KNDSSKYSLGNNSS- CCCCCCCCCCCCCC- | 33.27 | 23749301 | |
| 381 | Phosphorylation | KYSLGNNSS------ CCCCCCCCC------ | 41.23 | 22369663 | |
| 382 | Phosphorylation | YSLGNNSS------- CCCCCCCC------- | 46.49 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SUR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SUR1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SUR1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-349, AND MASSSPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-349, AND MASSSPECTROMETRY. | |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-349, AND MASSSPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-349, AND MASSSPECTROMETRY. | |
