UniProt ID | VPS24_YEAST | |
---|---|---|
UniProt AC | P36095 | |
Protein Name | Vacuolar protein-sorting-associated protein 24 | |
Gene Name | VPS24 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 224 | |
Subcellular Localization |
Endosome membrane Peripheral membrane protein. Endomembrane system Peripheral membrane protein. Endosomal and other punctate structures. |
|
Protein Description | Class E VPS protein implicated in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles. The lumenal sequestrated membrane proteins will be targeted into the vacuole after fusion of the endosome with the vacuole. Acts a component of the ESCRT-III complex, which appears to be critical for late steps in MVB sorting, such as membrane invagination and final cargo sorting and recruitment oflate-acting components of the sorting machinery. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complex assemblies. The DID4/VPS2-VPS24 subcomplex is required for the VPS4-dependent dissociation of ESCRT-III.. | |
Protein Sequence | MDYIKKAIWGPDPKEQQRRIRSVLRKNGRNIEKSLRELTVLQNKTQQLIKKSAKKNDVRTVRLYAKELYQINKQYDRMYTSRAQLDSVRMKIDEAIRMNTLSNQMADSAGLMREVNSLVRLPQLRNTMIELEKELMKSGIISEMVDDTMESVGDVGEEMDEAVDEEVNKIVEQYTNEKFKNVDQVPTVELAANEEEQEIPDEKVDEEADRMVNEMRERLRALQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Acetylation | AIWGPDPKEQQRRIR HHCCCCHHHHHHHHH | 75.44 | 24489116 | |
45 | Phosphorylation | LTVLQNKTQQLIKKS HHHHHHHHHHHHHHH | 29.15 | 21126336 | |
66 | Acetylation | RTVRLYAKELYQINK HHHHHHHHHHHHHHH | 34.39 | 24489116 | |
117 | Phosphorylation | GLMREVNSLVRLPQL HHHHHHHHHHHCHHH | 33.16 | 24909858 | |
178 | Acetylation | VEQYTNEKFKNVDQV HHHHHHHHCCCCCCC | 64.80 | 24489116 | |
180 | Acetylation | QYTNEKFKNVDQVPT HHHHHHCCCCCCCCC | 68.10 | 24489116 | |
203 | Ubiquitination | EQEIPDEKVDEEADR HHCCCCHHHHHHHHH | 63.47 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS24_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS24_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS24_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...