| UniProt ID | CANB_YEAST | |
|---|---|---|
| UniProt AC | P25296 | |
| Protein Name | Calcineurin subunit B | |
| Gene Name | CNB1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 175 | |
| Subcellular Localization | ||
| Protein Description | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.. | |
| Protein Sequence | MGAAPSKIVDGLLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGRIMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLRFAFKIYDIDKDGFISNGELFIVLKIMVGSNLDDEQLQQIVDRTIVENDSDGDGRLSFEEFKNAIETTEVAKSLTLQYDV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-myristoyl glycine | ------MGAAPSKIV ------CCCCCCHHH | 30.37 | - | |
| 2 | Myristoylation | ------MGAAPSKIV ------CCCCCCHHH | 30.37 | 1321337 | |
| 37 | Phosphorylation | FMKLDRDSSGSIDKN HHHCCCCCCCCCCHH | 37.18 | 28889911 | |
| 48 | Phosphorylation | IDKNEFMSIPGVSSN CCHHHCCCCCCCCCC | 30.84 | 30377154 | |
| 145 | Phosphorylation | RTIVENDSDGDGRLS CEEECCCCCCCCCCC | 55.89 | 27214570 | |
| 163 | Phosphorylation | FKNAIETTEVAKSLT HHHHHHHHHHHHHHE | 18.70 | 28889911 | |
| 168 | Phosphorylation | ETTEVAKSLTLQYDV HHHHHHHHHEEECCC | 19.49 | 22369663 | |
| 170 | Phosphorylation | TEVAKSLTLQYDV-- HHHHHHHEEECCC-- | 20.93 | 22369663 | |
| 173 | Phosphorylation | AKSLTLQYDV----- HHHHEEECCC----- | 23.06 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CANB_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CANB_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CANB_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Myristoylation | |
| Reference | PubMed |
| "Regulatory subunit (CNB1 gene product) of yeast Ca2+/calmodulin-dependent phosphoprotein phosphatases is required for adaptation topheromone."; Cyert M.S., Thorner J.; Mol. Cell. Biol. 12:3460-3469(1992). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND MYRISTOYLATION AT GLY-2. | |
