| UniProt ID | VPH2_YEAST | |
|---|---|---|
| UniProt AC | P32341 | |
| Protein Name | Vacuolar ATPase assembly integral membrane protein VPH2 | |
| Gene Name | VPH2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 215 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Required for vacuolar ATPase assembly.. | |
| Protein Sequence | MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQCSIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDDELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLVADVVVYNSYLKKLEEAKVKEKTKVEKKKVLSKITL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 54 | Ubiquitination | FYVKEYRKDSDLQCS HHHHHHCCCCCCCCC | 61.76 | 23749301 | |
| 108 | Ubiquitination | LEYQSMVKRSKSVFS HHHHHHHHHCCCCCC | 42.17 | 23749301 | |
| 110 | Phosphorylation | YQSMVKRSKSVFSLQ HHHHHHHCCCCCCCC | 24.46 | 19779198 | |
| 111 | Ubiquitination | QSMVKRSKSVFSLQE HHHHHHCCCCCCCCC | 55.46 | 23749301 | |
| 112 | Phosphorylation | SMVKRSKSVFSLQED HHHHHCCCCCCCCCC | 29.64 | 28889911 | |
| 115 | Phosphorylation | KRSKSVFSLQEDDEL HHCCCCCCCCCCCCC | 27.30 | 25752575 | |
| 129 | Ubiquitination | LTPSQINKQIKEQVT CCHHHHHHHHHHHHH | 55.84 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPH2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPH2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPH2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
