UniProt ID | UBS1_YEAST | |
---|---|---|
UniProt AC | P38290 | |
Protein Name | Ubiquitin-conjugating enzyme suppressor 1 | |
Gene Name | UBS1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 277 | |
Subcellular Localization | ||
Protein Description | Not known; its elevated expression suppresses the conditional cell cycle defects associated with UBC3/CDC34 mutations.. | |
Protein Sequence | MAYSLTRKLLKDWKYFMRHPEKTQGLFHVRPHDSDLHLWHVVMYEPRTSLEVYLLLYIGGNDQDPYIIMKCLSPNCCFPINRTVSMTHLNYLLLKDLGLQDLLFHIWQPLFHIQATEDLQYSPSTVKFNRAWNRIIYKDFKSYFPELIGTLQPGDYSIVKSYSKNHNISNSNGGSVNEFMSSYNAQSHTFHAQDNSKNPYTNSSIGKSSMLSTLNNNNVNKRTHDYNAIDFMTKNLLACDDDSIHPVVSSKRSRTLACPDETNDNRGSEHYTKRKKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
83 | Phosphorylation | CCFPINRTVSMTHLN CCCCCCCCCHHHHHH | 16.67 | 28132839 | |
85 | Phosphorylation | FPINRTVSMTHLNYL CCCCCCCHHHHHHHH | 19.83 | 28132839 | |
87 | Phosphorylation | INRTVSMTHLNYLLL CCCCCHHHHHHHHHH | 18.72 | 28132839 | |
91 | Phosphorylation | VSMTHLNYLLLKDLG CHHHHHHHHHHHHCC | 12.70 | 28132839 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBS1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UBS1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBS1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...