UniProt ID | GLO4_YEAST | |
---|---|---|
UniProt AC | Q12320 | |
Protein Name | Hydroxyacylglutathione hydrolase, mitochondrial | |
Gene Name | GLO4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 285 | |
Subcellular Localization | Mitochondrion matrix. | |
Protein Description | Thiolesterase that catalyzes the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid.. | |
Protein Sequence | MKFLLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSIDAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRAVGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRDELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKLKNAM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GLO4_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLO4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLO4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLO4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GLO2_YEAST | GLO2 | genetic | 18408719 | |
STE50_YEAST | STE50 | genetic | 20093466 | |
MFB1_YEAST | MFB1 | genetic | 20093466 | |
PAC11_YEAST | PAC11 | genetic | 20093466 | |
ATC1_YEAST | PMR1 | genetic | 20093466 | |
MAL11_YEAST | MAL11 | genetic | 20093466 | |
PTK1_YEAST | PTK1 | genetic | 20093466 | |
RIM13_YEAST | RIM13 | genetic | 20093466 | |
UBP15_YEAST | UBP15 | genetic | 20093466 | |
ADH6_YEAST | ADH6 | genetic | 20093466 | |
EOS1_YEAST | EOS1 | genetic | 20093466 | |
RU2A_YEAST | LEA1 | genetic | 20093466 | |
YME1_YEAST | YME1 | genetic | 20093466 | |
YP089_YEAST | YPR089W | genetic | 20093466 | |
QCR2_YEAST | QCR2 | genetic | 21623372 | |
PTK1_YEAST | PTK1 | genetic | 22282571 | |
VMS1_YEAST | VMS1 | genetic | 27708008 | |
ODO2_YEAST | KGD2 | genetic | 27708008 | |
ADH1_YEAST | ADH1 | genetic | 27708008 | |
MSB4_YEAST | MSB4 | genetic | 27708008 | |
FABD_YEAST | MCT1 | genetic | 27708008 | |
GGPPS_YEAST | BTS1 | genetic | 27708008 | |
RU2A_YEAST | LEA1 | genetic | 27708008 | |
YP089_YEAST | YPR089W | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...