UniProt ID | INO4_YEAST | |
---|---|---|
UniProt AC | P13902 | |
Protein Name | Protein INO4 | |
Gene Name | INO4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 151 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional activator of phospholipid synthetic genes (such as INO1, CHO1/PSS, CHO2/PEM1, OPI3/PEM2, etc.).. | |
Protein Sequence | MTNDIKEIQTIQPGLSEIKEIKGELANVKKRKRRSKKINKLTDGQIRINHVSSEKKRRELERAIFDELVAVVPDLQPQESRSELIIYLKSLSYLSWLYERNEKLRKQIIAKHEAKTGSSSSSDPVQEQNGNIRDLVPKELIWELGDGQSGQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Acetylation | RRSKKINKLTDGQIR HHHHHHHHCCCCCHH | 57.12 | 22865919 | |
116 | Phosphorylation | IAKHEAKTGSSSSSD HHHHHHCCCCCCCCC | 49.71 | 21440633 | |
118 | Phosphorylation | KHEAKTGSSSSSDPV HHHHCCCCCCCCCHH | 32.07 | 27017623 | |
119 | Phosphorylation | HEAKTGSSSSSDPVQ HHHCCCCCCCCCHHH | 35.27 | 27017623 | |
120 | Phosphorylation | EAKTGSSSSSDPVQE HHCCCCCCCCCHHHH | 35.24 | 27017623 | |
121 | Phosphorylation | AKTGSSSSSDPVQEQ HCCCCCCCCCHHHHC | 40.48 | 21440633 | |
122 | Phosphorylation | KTGSSSSSDPVQEQN CCCCCCCCCHHHHCC | 48.13 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of INO4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of INO4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of INO4_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...