| UniProt ID | INO4_YEAST | |
|---|---|---|
| UniProt AC | P13902 | |
| Protein Name | Protein INO4 | |
| Gene Name | INO4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 151 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcriptional activator of phospholipid synthetic genes (such as INO1, CHO1/PSS, CHO2/PEM1, OPI3/PEM2, etc.).. | |
| Protein Sequence | MTNDIKEIQTIQPGLSEIKEIKGELANVKKRKRRSKKINKLTDGQIRINHVSSEKKRRELERAIFDELVAVVPDLQPQESRSELIIYLKSLSYLSWLYERNEKLRKQIIAKHEAKTGSSSSSDPVQEQNGNIRDLVPKELIWELGDGQSGQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | Acetylation | RRSKKINKLTDGQIR HHHHHHHHCCCCCHH | 57.12 | 22865919 | |
| 116 | Phosphorylation | IAKHEAKTGSSSSSD HHHHHHCCCCCCCCC | 49.71 | 21440633 | |
| 118 | Phosphorylation | KHEAKTGSSSSSDPV HHHHCCCCCCCCCHH | 32.07 | 27017623 | |
| 119 | Phosphorylation | HEAKTGSSSSSDPVQ HHHCCCCCCCCCHHH | 35.27 | 27017623 | |
| 120 | Phosphorylation | EAKTGSSSSSDPVQE HHCCCCCCCCCHHHH | 35.24 | 27017623 | |
| 121 | Phosphorylation | AKTGSSSSSDPVQEQ HCCCCCCCCCHHHHC | 40.48 | 21440633 | |
| 122 | Phosphorylation | KTGSSSSSDPVQEQN CCCCCCCCCHHHHCC | 48.13 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of INO4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of INO4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of INO4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
