| UniProt ID | RXT3_YEAST | |
|---|---|---|
| UniProt AC | Q07458 | |
| Protein Name | Transcriptional regulatory protein RXT3 | |
| Gene Name | RXT3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 294 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the RPD3C(L) histone deacetylase complex (HDAC) responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.. | |
| Protein Sequence | MSVSEQDPNRAYRETQSQIYKLQETLLNSARTKNKQEEGQESNTHSFPEQYMHYQNGRNSAYDLPNVSSQSVLAFTEKHYPNKLKNLGTLYYNRFKEGSFDEDSTSYSDRHSFPYNLYDNTLPPPFLPAIGIQNINNIATLKITYEDIQASFNNIESPRKRNNEIWGCDIYSDDSDPILVLRHCGFKIGAPSGGSFHKLRRTPVNVTNQDNVTGNLPLLEGTPFDLEVELLFLPTLQKYPSVKRFDITSREWGSEATVIHDGLSYGIYSIVIKQRLDRDKPHEPNGYIKNLKWT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSVSEQDPN ------CCCCCCCCC | 34.06 | 22814378 | |
| 2 | Phosphorylation | ------MSVSEQDPN ------CCCCCCCCC | 34.06 | 28152593 | |
| 4 | Phosphorylation | ----MSVSEQDPNRA ----CCCCCCCCCHH | 23.41 | 24961812 | |
| 12 | Phosphorylation | EQDPNRAYRETQSQI CCCCCHHHHHHHHHH | 13.02 | 28132839 | |
| 21 | Acetylation | ETQSQIYKLQETLLN HHHHHHHHHHHHHHH | 45.37 | 24489116 | |
| 29 | Phosphorylation | LQETLLNSARTKNKQ HHHHHHHHHHHCCHH | 21.06 | 30377154 | |
| 78 | Acetylation | SVLAFTEKHYPNKLK HHHHHHHHHCCCHHH | 45.43 | 24489116 | |
| 85 | Acetylation | KHYPNKLKNLGTLYY HHCCCHHHCCCCCCC | 52.30 | 24489116 | |
| 99 | Phosphorylation | YNRFKEGSFDEDSTS CCCCCCCCCCCCCCC | 30.53 | 30377154 | |
| 105 | Phosphorylation | GSFDEDSTSYSDRHS CCCCCCCCCCCCCCC | 43.96 | 27017623 | |
| 106 | Phosphorylation | SFDEDSTSYSDRHSF CCCCCCCCCCCCCCC | 26.96 | 27017623 | |
| 192 | Phosphorylation | GFKIGAPSGGSFHKL CCEECCCCCCCCCCC | 56.08 | 30377154 | |
| 195 | Phosphorylation | IGAPSGGSFHKLRRT ECCCCCCCCCCCCCC | 27.92 | 30377154 | |
| 198 | Acetylation | PSGGSFHKLRRTPVN CCCCCCCCCCCCCCC | 41.50 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RXT3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RXT3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RXT3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
