| UniProt ID | UME1_YEAST | |
|---|---|---|
| UniProt AC | Q03010 | |
| Protein Name | Transcriptional regulatory protein UME1 | |
| Gene Name | UME1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 460 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Catalytic component of the RPD3 histone deacetylase complexes RPD3C(L) and RPD3C(S) responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events.. | |
| Protein Sequence | MSTLDIAEDNKIKNEEFKIWKKSIPSLYQHISSLKPIFGSGVDESPSTLRSIVFTNDSSCNKSKGVLSVPLLYSQGSEIFEVDCIVPLGLHYKKPESISEPLVQPDYTMESQKVEQTVLIPKWEFKGETIAKMIYVDNSEINVKVIALSTNGSLAWFREGVKSPVYTMMEPSTSLSSASSGNQNKPCVDFAISNDSKTLTVTKEKHLDNENATIKLIDNSGKIGEVLRTIPVPGIKNIQEIKFLNNQIFATCSDDGIIRFWGNEIGKKPLWILNDSLDGKTTCFAASPFVDTLFMTGTSGGALKVWDIRAVIALGDADAELNINQGHNKVNELFKVHHFYSEQVSKIEFSSISPMEVVTIGGLGNVYHWNFEPVFAIYNEIHEDFQGIISDELEAESMAFYHTEGCRREIGENNKVNTVAYHKYIEDLVATVDSDGLLTVYKPFTGKVLDGSREVGAAKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSTLDIAED ------CCCCCHHHH | 37.36 | 30377154 | |
| 3 | Phosphorylation | -----MSTLDIAEDN -----CCCCCHHHHC | 27.44 | 30377154 | |
| 177 | Phosphorylation | EPSTSLSSASSGNQN CCCCCCCCCCCCCCC | 37.15 | 28889911 | |
| 460 | Phosphorylation | REVGAAKS------- CCCCCCCC------- | 40.50 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UME1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UME1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UME1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-177, AND MASSSPECTROMETRY. | |
