| UniProt ID | BET3_YEAST | |
|---|---|---|
| UniProt AC | P36149 | |
| Protein Name | Trafficking protein particle complex subunit BET3 | |
| Gene Name | BET3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 193 | |
| Subcellular Localization | Golgi apparatus, cis-Golgi network. Endoplasmic reticulum. Preautophagosomal structure. | |
| Protein Description | Component of the TRAPP I, TRAPP II and TRAPP III complexes which act as guanine nucleotide exchange factors (GEF) for YPT1. TRAPP I plays a key role in the late stages of endoplasmic reticulum to Golgi traffic. TRAPP II plays a role in intra-Golgi transport. TRAPP III plays a role in autophagosome formation. Required for sporulation. Has a role late in meiosis following DNA replication.. | |
| Protein Sequence | MVSTTQSRSLKAMGEEIWKNKTEKINTELFTLTYGSIVAQLCQDYERDFNKVNDHLYSMGYNIGCRLIEDFLARTALPRCENLVKTSEVLSKCAFKIFLNITPNITNWSHNKDTFSLILDENPLADFVELPMDAMKSLWYSNILCGVLKGSLEMVQLDCDVWFVSDILRGDSQTEIKVKLNRILKDEIPIGED | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Ubiquitination | TTQSRSLKAMGEEIW CCCHHHHHHHHHHHH | 37.26 | 23749301 | |
| 19 | Acetylation | AMGEEIWKNKTEKIN HHHHHHHHCCCCCCC | 54.98 | 24489116 | |
| 80 | S-palmitoylation | ARTALPRCENLVKTS HHHHCHHHHHHHHHH | 3.72 | - | |
| 80 | S-palmitoylation | ARTALPRCENLVKTS HHHHCHHHHHHHHHH | 3.72 | 15692564 | |
| 85 | Ubiquitination | PRCENLVKTSEVLSK HHHHHHHHHHHHHHH | 49.88 | 23749301 | |
| 136 | Ubiquitination | ELPMDAMKSLWYSNI CCCHHHHHHHHHHHH | 44.08 | 17644757 | |
| 149 | Ubiquitination | NILCGVLKGSLEMVQ HHHHHHHHHCHHEEE | 44.01 | 17644757 | |
| 185 | Ubiquitination | VKLNRILKDEIPIGE HHHHHHHHCCCCCCC | 51.44 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BET3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BET3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BET3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Palmitoylation | |
| Reference | PubMed |
| "Structure of palmitoylated BET3: insights into TRAPP complex assemblyand membrane localization."; Turnbull A.P., Kummel D., Prinz B., Holz C., Schultchen J., Lang C.,Niesen F.H., Hofmann K.P., Delbruck H., Behlke J., Muller E.C.,Jarosch E., Sommer T., Heinemann U.; EMBO J. 24:875-884(2005). Cited for: MUTAGENESIS OF CYS-80, AND PALMITOYLATION AT CYS-80. | |
