| UniProt ID | DBR1_YEAST | |
|---|---|---|
| UniProt AC | P24309 | |
| Protein Name | Lariat debranching enzyme | |
| Gene Name | DBR1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 405 | |
| Subcellular Localization | Nucleus . Cytoplasm . | |
| Protein Description | Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It also participates in Ty1 retrovirus-like transposition via an RNA lariat intermediate in cDNA synthesis.. | |
| Protein Sequence | MTKLRIAVQGCCHGQLNQIYKEVSRIHAKTPIDLLIILGDFQSIRDGQDFKSIAIPPKYQRLGDFISYYNNEIEAPVPTIFIGGNHESMRHLMLLPHGGYVAKNIFYMGYSNVIWFKGIRIGSLSGIWKEWDFNKQRPDWNDLENNNWKANIRNLYHVRISDIAPLFMIKHRIDIMLSHDWPNGVVYHGDTKHLLKLKPFFEQDIKEGKLGSPVTWQLLRDLRPQWWLSAHLHVRFMASIKHNKRSHEPPNKSTSKTKKNNNEIDLDLSSDEDERSGIMNCQEENEYDSKYGETRFLALDKCLPRRRWLEILEIEPDTSHASWKDENHRMFWDPEFINNLVICQKNKNLLSNKPFNSVNWIELSQSNREEGRDIDWENYAIPAYTLDIQKDEVRQTKAFISKFMT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 111 | Phosphorylation | NIFYMGYSNVIWFKG CEEEECCCCEEEEEC | 20.92 | 30377154 | |
| 269 | Phosphorylation | NEIDLDLSSDEDERS CEECCCCCCCHHHHH | 35.10 | 22369663 | |
| 270 | Phosphorylation | EIDLDLSSDEDERSG EECCCCCCCHHHHHC | 52.93 | 22369663 | |
| 357 | Phosphorylation | LSNKPFNSVNWIELS CCCCCCCCCCCEECC | 19.73 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DBR1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DBR1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DBR1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-269 AND SER-270, ANDMASS SPECTROMETRY. | |
