| UniProt ID | DPH4_YEAST | |
|---|---|---|
| UniProt AC | P47138 | |
| Protein Name | Diphthamide biosynthesis protein 4 | |
| Gene Name | JJJ3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 172 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Required for the first step of diphthamide biosynthesis, the transfer of 3-amino-3-carboxypropyl from S-adenosyl-L-methionine to a histidine residue. Diphthamide is a post-translational modification of histidine which occurs in elongation factor 2.. | |
| Protein Sequence | MSLVNSLTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTRREYDRLILENYKRQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPRCQFVGGFHFSESLLDECIDNVDAMERSHSGYQLLTQCSACSLWLKVNFDIEEEQEGQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSLVNSLTH ------CCCCCCCCC | 40.81 | 22814378 | |
| 6 | Phosphorylation | --MSLVNSLTHYEIL --CCCCCCCCCCEEC | 27.45 | 30377154 | |
| 8 | Phosphorylation | MSLVNSLTHYEILRI CCCCCCCCCCEECCC | 23.41 | 30377154 | |
| 10 | Phosphorylation | LVNSLTHYEILRIPS CCCCCCCCEECCCCC | 10.22 | 30377154 | |
| 41 | Phosphorylation | NTHPDKLSKSIHDTV HHCCCHHHHHHHHHH | 30.05 | 29136822 | |
| 43 | Phosphorylation | HPDKLSKSIHDTVSN CCCHHHHHHHHHHHC | 23.06 | 29136822 | |
| 47 | Phosphorylation | LSKSIHDTVSNVTIN HHHHHHHHHHCCHHH | 16.21 | 29136822 | |
| 49 | Phosphorylation | KSIHDTVSNVTINKI HHHHHHHHCCHHHHH | 27.89 | 29136822 | |
| 52 | Phosphorylation | HDTVSNVTINKIQDA HHHHHCCHHHHHHHH | 24.08 | 29136822 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPH4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPH4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPH4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
