| UniProt ID | LSM1_YEAST | |
|---|---|---|
| UniProt AC | P47017 | |
| Protein Name | Sm-like protein LSm1 | |
| Gene Name | LSM1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 172 | |
| Subcellular Localization | Nucleus . Cytoplasm . Cytoplasm, P-body . | |
| Protein Description | Component of the cytoplasmic LSM1-LSM7 complex which is involved in mRNA degradation by activating the decapping step. The LSM1-LSM7 complex binds RNA with a preference for poly-U ends.. | |
| Protein Sequence | MSANSKDRNQSNQDAKRQQQNFPKKISEGEADLYLDQYNFTTTAAIVSSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLEAMERIPFKEAWLTKQKNDEKRFKEETHKGKKMARHGIVYDFHKSDMY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 93 | Ubiquitination | IYFSEENKYAEEDRG HHCCCCCCCCCCCCC | 49.47 | 23749301 | |
| 133 | Ubiquitination | AMERIPFKEAWLTKQ HHHHCCHHHHHHHCC | 40.96 | 23749301 | |
| 133 | Acetylation | AMERIPFKEAWLTKQ HHHHCCHHHHHHHCC | 40.96 | 24489116 | |
| 148 | Acetylation | KNDEKRFKEETHKGK CCCHHHHHHHHHHCH | 59.69 | 25381059 | |
| 168 | Ubiquitination | GIVYDFHKSDMY--- CCEEEEEHHCCC--- | 48.41 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSM1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSM1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSM1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
