dbPTM

MET16_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MET16_YEAST
UniProt AC	P18408
Protein Name	Phosphoadenosine phosphosulfate reductase
Gene Name	MET16
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	261
Subcellular Localization
Protein Description	The NADP dependent reduction of PAPS into sulfite involves thioredoxin which probably plays the role of a thiol carrier..
Protein Sequence	MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAFGLTGLVTIDMLSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPKNQTIHVYKPDGCESEADFASKYGDFLWEKDDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDELNGILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWKGKAKTECGIHEASRFAQFLKQDA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
139	Acetylation	DKYDYLAKVEPAHRA CCCCEECCCCHHHHH	44.53	22865919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MET16_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MET16_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MET16_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MET16_YEAST	MET16	physical	18991405
SWC5_YEAST	SWC5	genetic	20093466
PAT1_YEAST	PAT1	genetic	20093466
PP2A1_YEAST	PPH21	genetic	20093466
VMS1_YEAST	VMS1	genetic	20093466
SWF1_YEAST	SWF1	genetic	20093466
LCMT1_YEAST	PPM1	genetic	20093466
MED5_YEAST	NUT1	genetic	20093466
ELP2_YEAST	ELP2	genetic	20093466
TBP7_YEAST	YTA7	genetic	20093466
COPE_YEAST	SEC28	genetic	20093466
LSM1_YEAST	LSM1	genetic	20093466
IRA2_YEAST	IRA2	genetic	20093466
SFL1_YEAST	SFL1	genetic	20093466
ULS1_YEAST	ULS1	genetic	20093466
MET22_YEAST	MET22	genetic	21623372
METK1_YEAST	SAM1	genetic	21623372
G3P3_YEAST	TDH3	genetic	21623372
CBS_YEAST	CYS4	genetic	21623372
CSG2_YEAST	CSG2	genetic	21623372
6PGD1_YEAST	GND1	genetic	21623372
CHO2_YEAST	CHO2	genetic	21623372
ALAM_YEAST	ALT1	genetic	21623372
DCOR_YEAST	SPE1	genetic	21623372
ACON2_YEAST	ACO2	genetic	21623372
MTHR1_YEAST	MET12	genetic	21623372
COQ4_YEAST	COQ4	genetic	21623372
SCS7_YEAST	SCS7	genetic	21623372
RCY1_YEAST	RCY1	genetic	27708008
PAT1_YEAST	PAT1	genetic	27708008
LSM6_YEAST	LSM6	genetic	27708008
LCMT1_YEAST	PPM1	genetic	27708008
LSM1_YEAST	LSM1	genetic	27708008
ARP6_YEAST	ARP6	genetic	27708008
EAF7_YEAST	EAF7	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MET16_YEAST

Related Literatures of Post-Translational Modification