| UniProt ID | PP2A1_YEAST | |
|---|---|---|
| UniProt AC | P23594 | |
| Protein Name | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit | |
| Gene Name | PPH21 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 369 | |
| Subcellular Localization | ||
| Protein Description | Exact function not known, phosphatase 2A performs an essential cellular function.. | |
| Protein Sequence | MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLKPGSSGIADHKSSKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPSVSRKTPDYFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Phosphorylation | VDDLKPGSSGIADHK HHHCCCCCCCCCCCC | 33.64 | 27717283 | |
| 49 | Phosphorylation | DDLKPGSSGIADHKS HHCCCCCCCCCCCCC | 39.88 | 27717283 | |
| 56 | Phosphorylation | SGIADHKSSKPLELN CCCCCCCCCCCCCCC | 39.93 | 21440633 | |
| 231 | Phosphorylation | FCLHGGLSPMIETID EEECCCCHHHHHHHH | 18.72 | 28889911 | |
| 272 | Phosphorylation | DRGGWGISPRGAGFT CCCCCCCCCCCCCCC | 12.47 | 22369663 | |
| 363 | Ubiquitination | GEPSVSRKTPDYFL- CCCCCCCCCCCCCC- | 57.83 | 23749301 | |
| 364 | Phosphorylation | EPSVSRKTPDYFL-- CCCCCCCCCCCCC-- | 21.93 | 27214570 | |
| 369 | Methylation | RKTPDYFL------- CCCCCCCC------- | 5.81 | 11060018 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP2A1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2A1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2A1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-231, AND MASSSPECTROMETRY. | |
