UniProt ID | PP2A1_YEAST | |
---|---|---|
UniProt AC | P23594 | |
Protein Name | Serine/threonine-protein phosphatase PP2A-1 catalytic subunit | |
Gene Name | PPH21 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 369 | |
Subcellular Localization | ||
Protein Description | Exact function not known, phosphatase 2A performs an essential cellular function.. | |
Protein Sequence | MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLKPGSSGIADHKSSKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPSVSRKTPDYFL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
48 | Phosphorylation | VDDLKPGSSGIADHK HHHCCCCCCCCCCCC | 33.64 | 27717283 | |
49 | Phosphorylation | DDLKPGSSGIADHKS HHCCCCCCCCCCCCC | 39.88 | 27717283 | |
56 | Phosphorylation | SGIADHKSSKPLELN CCCCCCCCCCCCCCC | 39.93 | 21440633 | |
231 | Phosphorylation | FCLHGGLSPMIETID EEECCCCHHHHHHHH | 18.72 | 28889911 | |
272 | Phosphorylation | DRGGWGISPRGAGFT CCCCCCCCCCCCCCC | 12.47 | 22369663 | |
363 | Ubiquitination | GEPSVSRKTPDYFL- CCCCCCCCCCCCCC- | 57.83 | 23749301 | |
364 | Phosphorylation | EPSVSRKTPDYFL-- CCCCCCCCCCCCC-- | 21.93 | 27214570 | |
369 | Methylation | RKTPDYFL------- CCCCCCCC------- | 5.81 | 11060018 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP2A1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP2A1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP2A1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-231, AND MASSSPECTROMETRY. |