| UniProt ID | CSK22_YEAST | |
|---|---|---|
| UniProt AC | P19454 | |
| Protein Name | Casein kinase II subunit alpha' | |
| Gene Name | CKA2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 339 | |
| Subcellular Localization | ||
| Protein Description | Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. May play a role in cell proliferation. Required for cell viability.. | |
| Protein Sequence | MPLPPSTLNQKSNRVYSVARVYKNACEERPQEYWDYEQGVTIDWGKISNYEIINKIGRGKYSEVFSGRCIVNNQKCVIKVLKPVKMKKIYRELKILTNLTGGPNVVGLYDIVQDADSKIPALIFEEIKNVDFRTLYPTFKLPDIQYYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAEFYHPGVDYNVRVASRYHKGPELLVNLNQYDYSLDLWSVGCMLAAIVFKKEPFFKGSSNPDQLVKIATVLGTKELLGYLGKYGLHLPSEYDNIMRDFTKKSWTHFITSETKLAVPEVVDLIDNLLRYDHQERLTAKEAMDHKFFKTKFE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 55 | Acetylation | SNYEIINKIGRGKYS CCCCHHHCCCCCCCC | 35.81 | 24489116 | |
| 60 | Acetylation | INKIGRGKYSEVFSG HHCCCCCCCCEEECC | 44.22 | 22865919 | |
| 100 | Phosphorylation | LKILTNLTGGPNVVG HHHHHHCCCCCCEEE | 42.01 | 21440633 | |
| 169 | Ubiquitination | GIMHRDVKPQNVMID CCCCCCCCCCCEEEC | 45.21 | 23749301 | |
| 245 | Acetylation | FKKEPFFKGSSNPDQ HCCCCCCCCCCCHHH | 59.26 | 22865919 | |
| 263 | Ubiquitination | IATVLGTKELLGYLG HHHHHCHHHHHHHHH | 44.56 | 24961812 | |
| 263 | Acetylation | IATVLGTKELLGYLG HHHHHCHHHHHHHHH | 44.56 | 24489116 | |
| 297 | Phosphorylation | KSWTHFITSETKLAV HHHHCCCCCCCCCCC | 21.40 | 19823750 | |
| 298 | Phosphorylation | SWTHFITSETKLAVP HHHCCCCCCCCCCCH | 38.15 | 19823750 | |
| 300 | Phosphorylation | THFITSETKLAVPEV HCCCCCCCCCCCHHH | 31.00 | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSK22_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSK22_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSK22_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
