PXR1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PXR1_YEAST
• UniProt AC: P53335
• Protein Name: Protein PXR1
• Gene Name: PXR1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 271
• Subcellular Localization: Nucleus, nucleolus .
• Protein Description: Involved in rRNA-processing at A0, A1 and A2 sites through its action in U18 and U24 snoRNA 3'-end final trimming. Negative regulator of telomerase through competition for binding to EST2 with TLC1..
• Protein Sequence: MGLAATRTKQRFGLDPRNTAWSNDTSRFGHQFLEKFGWKPGMGLGLSPMNSNTSHIKVSIKDDNVGLGAKLKRKDKKDEFDNGECAGLDVFQRILGRLNGKESKISEELDTQRKQKIIDGKWGIHFVKGEVLASTWDPKTHKLRNYSNAKKRKREGDDSEDEDDDDKEDKDSDKKKHKKHKKHKKDKKKDKKDKKEHKKHKKEEKRLKKEKRAEKTKETKKTSKLKSSESASNIPDAVNTRLSVRSKWIKQKRAALMDSKALNEIFMITND

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MGLAATRTKQRFG --CCCCCCCCHHHCC	33.01	28889911
61	Succinylation	SHIKVSIKDDNVGLG CCEEEEECCCCCCHH	52.07	23954790
106	Phosphorylation	NGKESKISEELDTQR CCCHHHHHHHHHHHH	28.84	28889911
111	Phosphorylation	KISEELDTQRKQKII HHHHHHHHHHHHHHH	42.78	28889911
140	Phosphorylation	ASTWDPKTHKLRNYS EECCCCCHHHHCCCH	29.63	21551504
147	Phosphorylation	THKLRNYSNAKKRKR HHHHCCCHHHHHHHC	33.58	19823750
159	Phosphorylation	RKREGDDSEDEDDDD HHCCCCCCCCCCCCC	52.25	25521595
227	Phosphorylation	KKTSKLKSSESASNI HHHHHCCCCHHHHCC	50.18	22369663
228	Phosphorylation	KTSKLKSSESASNIP HHHHCCCCHHHHCCC	33.70	22369663
230	Phosphorylation	SKLKSSESASNIPDA HHCCCCHHHHCCCHH	38.66	22369663
232	Phosphorylation	LKSSESASNIPDAVN CCCCHHHHCCCHHHH	44.57	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PXR1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PXR1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PXR1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YME2_YEAST	YME2	physical	11805837
GDE1_YEAST	GDE1	physical	11805837
GAR1_YEAST	GAR1	physical	18467557
NOP10_YEAST	NOP10	physical	18467557
TMA23_YEAST	TMA23	physical	18467557
SRP40_YEAST	SRP40	physical	18467557
PXR1_YEAST	PXR1	physical	18467557
CSK2B_YEAST	CKB1	genetic	19061648
MOG1_YEAST	MOG1	genetic	19061648
PRP43_YEAST	PRP43	physical	25808954
CEP70_HUMAN	CEP70	physical	27107014
THAP1_HUMAN	THAP1	physical	27107014

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A multidimensional chromatography technology for in-depthphosphoproteome analysis.";
Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.;
Mol. Cell. Proteomics 7:1389-1396(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230 AND SER-232, ANDMASS SPECTROMETRY.
PubMed: 18407956