| UniProt ID | THAP1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NVV9 | |
| Protein Name | THAP domain-containing protein 1 | |
| Gene Name | THAP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 213 | |
| Subcellular Localization | Nucleus, nucleoplasm . Nucleus, PML body . | |
| Protein Description | DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. Specifically binds the 5'-[AT]NTNN[GT]GGCA[AGT]-3' core DNA sequence and acts by modulating expression of pRB-E2F cell-cycle target genes, including RRM1. Component of a THAP1/THAP3-HCFC1-OGT complex that is required for the regulation of the transcriptional activity of RRM1. May also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis.. | |
| Protein Sequence | MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | AYGCKNRYDKDKPVS CCCCCCCCCCCCCCC | 36.42 | - | |
| 18 | Sumoylation | KNRYDKDKPVSFHKF CCCCCCCCCCCEECC | 53.73 | - | |
| 18 | Sumoylation | KNRYDKDKPVSFHKF CCCCCCCCCCCEECC | 53.73 | - | |
| 21 | Phosphorylation | YDKDKPVSFHKFPLT CCCCCCCCEECCCCC | 30.11 | - | |
| 181 | Ubiquitination | ERQLEKLKEVVHFQK HHHHHHHHHHHHHHH | 60.58 | 29967540 | |
| 188 | Ubiquitination | KEVVHFQKEKDDVSE HHHHHHHHCCCCCHH | 66.83 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THAP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THAP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THAP1_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
