UniProt ID | KR107_HUMAN | |
---|---|---|
UniProt AC | P60409 | |
Protein Name | Keratin-associated protein 10-7 | |
Gene Name | KRTAP10-7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 375 | |
Subcellular Localization | ||
Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
Protein Sequence | MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPSCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCMPVCCKTVCCKPVYCVPVCSGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQPACCTSSQSQQGCCVPVCCKPVCCVPVCSGASSSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPTCCVPVPSCCAPTSSCQASCCRPASCVSLLCRPACSRPACCGPTSTQKSSC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MAASTMSVCSSD ---CCCCCCEECCCC | 14.56 | 24260401 | |
14 | Phosphorylation | SVCSSDLSYGSRVCL EECCCCCCCCCCEEE | 32.22 | - | |
15 | Phosphorylation | VCSSDLSYGSRVCLP ECCCCCCCCCCEEEC | 26.81 | 24114839 | |
296 | Phosphorylation | SSSCCQQSSCQPACC CHHHHCCCCCCCCEE | 13.75 | 20068231 | |
297 | Phosphorylation | SSCCQQSSCQPACCT HHHHCCCCCCCCEEE | 16.66 | 20068231 | |
304 | Phosphorylation | SCQPACCTTSCCRPS CCCCCEEECCCCCCC | 22.94 | 20068231 | |
305 | Phosphorylation | CQPACCTTSCCRPSS CCCCEEECCCCCCCC | 13.07 | 20068231 | |
306 | Phosphorylation | QPACCTTSCCRPSSS CCCEEECCCCCCCCC | 7.96 | 20068231 | |
325 | Phosphorylation | CRPVCRPTCCVPVPS EECCCCCCEEEECCC | 10.13 | 22210691 | |
332 | Phosphorylation | TCCVPVPSCCAPTSS CEEEECCCCCCCCCC | 23.28 | 22210691 | |
337 | Phosphorylation | VPSCCAPTSSCQASC CCCCCCCCCCCCCCC | 18.10 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KR107_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KR107_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KR107_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
KR107_HUMAN | KRTAP10-7 | physical | 25416956 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
KRA56_HUMAN | KRTAP5-6 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...