KR107_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KR107_HUMAN
• UniProt AC: P60409
• Protein Name: Keratin-associated protein 10-7
• Gene Name: KRTAP10-7
• Organism: Homo sapiens (Human).
• Sequence Length: 375
• Protein Description: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins..
• Protein Sequence: MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPSCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCMPVCCKTVCCKPVYCVPVCSGDSSCCQQSSCQSACCTSSPCQQACCVPICCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCISSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPTCSDDSGSCCQPACCTSSQSQQGCCVPVCCKPVCCVPVCSGASSSCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPTCCVPVPSCCAPTSSCQASCCRPASCVSLLCRPACSRPACCGPTSTQKSSC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MAASTMSVCSSD ---CCCCCCEECCCC	14.56	24260401
14	Phosphorylation	SVCSSDLSYGSRVCL EECCCCCCCCCCEEE	32.22	-
15	Phosphorylation	VCSSDLSYGSRVCLP ECCCCCCCCCCEEEC	26.81	24114839
296	Phosphorylation	SSSCCQQSSCQPACC CHHHHCCCCCCCCEE	13.75	20068231
297	Phosphorylation	SSCCQQSSCQPACCT HHHHCCCCCCCCEEE	16.66	20068231
304	Phosphorylation	SCQPACCTTSCCRPS CCCCCEEECCCCCCC	22.94	20068231
305	Phosphorylation	CQPACCTTSCCRPSS CCCCEEECCCCCCCC	13.07	20068231
306	Phosphorylation	QPACCTTSCCRPSSS CCCEEECCCCCCCCC	7.96	20068231
325	Phosphorylation	CRPVCRPTCCVPVPS EECCCCCCEEEECCC	10.13	22210691
332	Phosphorylation	TCCVPVPSCCAPTSS CEEEECCCCCCCCCC	23.28	22210691
337	Phosphorylation	VPSCCAPTSSCQASC CCCCCCCCCCCCCCC	18.10	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KR107_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KR107_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KR107_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
KR107_HUMAN	KRTAP10-7	physical	25416956
KR109_HUMAN	KRTAP10-9	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
KRA56_HUMAN	KRTAP5-6	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.