KR108_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KR108_HUMAN
• UniProt AC: P60410
• Protein Name: Keratin-associated protein 10-8
• Gene Name: KRTAP10-8
• Organism: Homo sapiens (Human).
• Sequence Length: 259
• Protein Description: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins..
• Protein Sequence: MADACCTRTYVIAASTMSVCSSDVGHVSRVSSPSTCTGSSWQVDNCQESCCEPRSCASSCCTPSCCAPAPCLALVCAPVSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKSNCCKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVCSGASSLCCQKSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVPSCCVPASSCQPSCCHPASCLSFLCRPACSRLAC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	RTYVIAASTMSVCSS EEEEEEEECCHHHCC	18.67	-
16	Phosphorylation	TYVIAASTMSVCSSD EEEEEEECCHHHCCC	14.56	-
191	Phosphorylation	SSLCCQKSSCQPACC CHHHCCCCCCCCCEE	15.52	20068231
192	Phosphorylation	SLCCQKSSCQPACCT HHHCCCCCCCCCEEE	24.65	20068231
199	Phosphorylation	SCQPACCTTSCCRPS CCCCCEEECCCCCCC	22.94	20068231
200	Phosphorylation	CQPACCTTSCCRPSS CCCCEEECCCCCCCC	13.07	20068231
201	Phosphorylation	QPACCTTSCCRPSSS CCCEEECCCCCCCCC	7.96	20068231
247	Phosphorylation	CHPASCLSFLCRPAC CCHHHHHHHHHHHHH	22.09	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KR108_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KR108_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KR108_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
CK087_HUMAN	C11orf87	physical	25416956
KRA56_HUMAN	KRTAP5-6	physical	25416956
TYMOS_HUMAN	TYMSOS	physical	25416956
KR411_HUMAN	KRTAP4-11	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.