NT2NL_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NT2NL_HUMAN
• UniProt AC: Q7Z3S9
• Protein Name: Notch homolog 2 N-terminal-like protein
• Gene Name: NOTCH2NL
• Organism: Homo sapiens (Human).
• Sequence Length: 236
• Subcellular Localization: Secreted . Cytoplasm .
• Protein Description: May function in the Notch signaling pathway and regulate neutrophil differentiation..
• Protein Sequence: MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of NT2NL_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NT2NL_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NT2NL_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NT2NL_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELNE_HUMAN	ELANE	physical	14673143
RPB7_HUMAN	POLR2G	physical	21988832
KR261_HUMAN	KRTAP26-1	physical	25416956
CK087_HUMAN	C11orf87	physical	25416956
KRA56_HUMAN	KRTAP5-6	physical	25416956
KR411_HUMAN	KRTAP4-11	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.