KR261_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KR261_HUMAN
• UniProt AC: Q6PEX3
• Protein Name: Keratin-associated protein 26-1
• Gene Name: KRTAP26-1
• Organism: Homo sapiens (Human).
• Sequence Length: 210
• Protein Description: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins..
• Protein Sequence: MSCPNYCSGNSNSGSLRTSRHIPLTSIDLCPTSVSCGDVLYLPTSSQDHTWVTDNCQETCGEPTSCQPVHCETGNLETSCGSSTAYYVPRPCQGSSFLPASFFSSSCLPVSCRPQRYVSSGCRPLRPLLNSYQPIGDCVPNAYRPQFCLSKSCQPQNLLTSGCQPSSCLAYRPQSLHVVSSSLRPLGPLFSGCQPLTHVFSTCRPSCSGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSCPNYCSG ------CCCCCCCCC	37.98	24043423
6	Phosphorylation	--MSCPNYCSGNSNS --CCCCCCCCCCCCC	3.52	24043423
8	Phosphorylation	MSCPNYCSGNSNSGS CCCCCCCCCCCCCCC	30.56	24043423
11	Phosphorylation	PNYCSGNSNSGSLRT CCCCCCCCCCCCCCC	35.58	24043423
13	Phosphorylation	YCSGNSNSGSLRTSR CCCCCCCCCCCCCCC	29.58	24043423
15	Phosphorylation	SGNSNSGSLRTSRHI CCCCCCCCCCCCCCC	17.94	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KR261_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KR261_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KR261_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR261_HUMAN	KRTAP26-1	physical	25416956
KRA56_HUMAN	KRTAP5-6	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.