| UniProt ID | KRA56_HUMAN | |
|---|---|---|
| UniProt AC | Q6L8G9 | |
| Protein Name | Keratin-associated protein 5-6 | |
| Gene Name | KRTAP5-6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 129 | |
| Subcellular Localization | ||
| Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
| Protein Sequence | MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCTSCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCCKPCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Phosphorylation | CSCTSCGSCGGSKGC CCCCCCCCCCCCCCC | 17.57 | - | |
| 56 | Phosphorylation | SCGSCGGSKGCCGSC CCCCCCCCCCCCCCC | 15.91 | - | |
| 62 | Phosphorylation | GSKGCCGSCGGSKGG CCCCCCCCCCCCCCC | 8.82 | 24114839 | |
| 66 | Phosphorylation | CCGSCGGSKGGCGSC CCCCCCCCCCCCCCC | 17.26 | 24114839 | |
| 67 | Ubiquitination | CGSCGGSKGGCGSCG CCCCCCCCCCCCCCC | 63.70 | 23503661 | |
| 72 | Phosphorylation | GSKGGCGSCGGSKGG CCCCCCCCCCCCCCC | 17.42 | 24114839 | |
| 76 | Phosphorylation | GCGSCGGSKGGCGSC CCCCCCCCCCCCCCC | 17.26 | 24114839 | |
| 77 | Ubiquitination | CGSCGGSKGGCGSCG CCCCCCCCCCCCCCC | 63.70 | 23503661 | |
| 82 | Phosphorylation | GSKGGCGSCGCSQCS CCCCCCCCCCCCCCC | 16.06 | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRA56_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRA56_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRA56_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of KRA56_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
