UniProt ID | KRA56_HUMAN | |
---|---|---|
UniProt AC | Q6L8G9 | |
Protein Name | Keratin-associated protein 5-6 | |
Gene Name | KRTAP5-6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 129 | |
Subcellular Localization | ||
Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
Protein Sequence | MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCTSCGSCGGSKGCCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCCKPCYCSSGCGSSCCQSSCCKPCCSQASCCVPICCQCKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Phosphorylation | CSCTSCGSCGGSKGC CCCCCCCCCCCCCCC | 17.57 | - | |
56 | Phosphorylation | SCGSCGGSKGCCGSC CCCCCCCCCCCCCCC | 15.91 | - | |
62 | Phosphorylation | GSKGCCGSCGGSKGG CCCCCCCCCCCCCCC | 8.82 | 24114839 | |
66 | Phosphorylation | CCGSCGGSKGGCGSC CCCCCCCCCCCCCCC | 17.26 | 24114839 | |
67 | Ubiquitination | CGSCGGSKGGCGSCG CCCCCCCCCCCCCCC | 63.70 | 23503661 | |
72 | Phosphorylation | GSKGGCGSCGGSKGG CCCCCCCCCCCCCCC | 17.42 | 24114839 | |
76 | Phosphorylation | GCGSCGGSKGGCGSC CCCCCCCCCCCCCCC | 17.26 | 24114839 | |
77 | Ubiquitination | CGSCGGSKGGCGSCG CCCCCCCCCCCCCCC | 63.70 | 23503661 | |
82 | Phosphorylation | GSKGGCGSCGCSQCS CCCCCCCCCCCCCCC | 16.06 | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRA56_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRA56_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRA56_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of KRA56_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...