| UniProt ID | KR103_HUMAN | |
|---|---|---|
| UniProt AC | P60369 | |
| Protein Name | Keratin-associated protein 10-3 | |
| Gene Name | KRTAP10-3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 221 | |
| Subcellular Localization | ||
| Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
| Protein Sequence | MATSTMSVCSSAYSDSWQVDACPESCCEPPCCATSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSPCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCKPVCCKPICCVPVCSGASSSCCQQSSRQPACCTTSCCRPSSSVSLLCRPVCRSTCCVPIPSCCAPASTCQPSCCRPASCVSLLCRPTCSRLSSACCGLSSGQKSSC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 150 | Phosphorylation | QPACCTTSCCRPSSS CCCEEECCCCCCCCC | 7.96 | 20068231 | |
| 219 | Phosphorylation | GLSSGQKSSC----- CCCCCCCCCC----- | 29.11 | 30631047 | |
| 220 | Phosphorylation | LSSGQKSSC------ CCCCCCCCC------ | 30.77 | 30631047 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KR103_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KR103_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KR103_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
| KR261_HUMAN | KRTAP26-1 | physical | 25416956 | |
| CJ062_HUMAN | C10orf62 | physical | 25416956 | |
| KRA56_HUMAN | KRTAP5-6 | physical | 25416956 | |
| TYMOS_HUMAN | TYMSOS | physical | 25416956 | |
| KR411_HUMAN | KRTAP4-11 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
