UniProt ID | KR109_HUMAN | |
---|---|---|
UniProt AC | P60411 | |
Protein Name | Keratin-associated protein 10-9 | |
Gene Name | KRTAP10-9 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization | ||
Protein Description | In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.. | |
Protein Sequence | MAASTMSIRSSAYSDSWQVDDCPESCCEPPCCATSCCAPAPCLTLVCTPVSRVSSPCCQVTCEPSPCQSGCTSSCTPSCCQQSSCQPAYCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSYQPACCASSSCQPACCVPVCCKPVCCAPTCSEDSYSCCQQSSCQPACCTSSPCQQSYCVPVCCKPVCCKPICCVPVCSGASSLCCQQSGCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVSSCCAPTSSRQPSYCRQASCVSLLCRPVCSRPACYSFSSGQKSSC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAASTMSIRSS ----CCCCCCCCCCC | 18.33 | 23403867 | |
5 | Phosphorylation | ---MAASTMSIRSSA ---CCCCCCCCCCCC | 15.37 | 23403867 | |
7 | Phosphorylation | -MAASTMSIRSSAYS -CCCCCCCCCCCCCC | 18.22 | 23403867 | |
222 | Phosphorylation | CQPACCTTSCCRPSS CCCCEEECCCCCCCC | 13.07 | 20068231 | |
223 | Phosphorylation | QPACCTTSCCRPSSS CCCEEECCCCCCCCC | 7.96 | 20068231 | |
285 | Phosphorylation | RPACYSFSSGQKSSC CCEEEECCCCCCCCC | 27.84 | - | |
286 | Phosphorylation | PACYSFSSGQKSSC- CEEEECCCCCCCCC- | 43.14 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KR109_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KR109_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KR109_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR108_HUMAN | KRTAP10-8 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
KR261_HUMAN | KRTAP26-1 | physical | 25416956 | |
CK087_HUMAN | C11orf87 | physical | 25416956 | |
CJ062_HUMAN | C10orf62 | physical | 25416956 | |
KRA56_HUMAN | KRTAP5-6 | physical | 25416956 | |
TYMOS_HUMAN | TYMSOS | physical | 25416956 | |
KR411_HUMAN | KRTAP4-11 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...