KR109_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KR109_HUMAN
• UniProt AC: P60411
• Protein Name: Keratin-associated protein 10-9
• Gene Name: KRTAP10-9
• Organism: Homo sapiens (Human).
• Sequence Length: 292
• Protein Description: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins..
• Protein Sequence: MAASTMSIRSSAYSDSWQVDDCPESCCEPPCCATSCCAPAPCLTLVCTPVSRVSSPCCQVTCEPSPCQSGCTSSCTPSCCQQSSCQPAYCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSYQPACCASSSCQPACCVPVCCKPVCCAPTCSEDSYSCCQQSSCQPACCTSSPCQQSYCVPVCCKPVCCKPICCVPVCSGASSLCCQQSGCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVSSCCAPTSSRQPSYCRQASCVSLLCRPVCSRPACYSFSSGQKSSC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MAASTMSIRSS ----CCCCCCCCCCC	18.33	23403867
5	Phosphorylation	---MAASTMSIRSSA ---CCCCCCCCCCCC	15.37	23403867
7	Phosphorylation	-MAASTMSIRSSAYS -CCCCCCCCCCCCCC	18.22	23403867
222	Phosphorylation	CQPACCTTSCCRPSS CCCCEEECCCCCCCC	13.07	20068231
223	Phosphorylation	QPACCTTSCCRPSSS CCCEEECCCCCCCCC	7.96	20068231
285	Phosphorylation	RPACYSFSSGQKSSC CCEEEECCCCCCCCC	27.84	-
286	Phosphorylation	PACYSFSSGQKSSC- CEEEECCCCCCCCC-	43.14	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KR109_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KR109_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KR109_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KR109_HUMAN	KRTAP10-9	physical	25416956
KR108_HUMAN	KRTAP10-8	physical	25416956
KR103_HUMAN	KRTAP10-3	physical	25416956
NT2NL_HUMAN	NOTCH2NL	physical	25416956
KR261_HUMAN	KRTAP26-1	physical	25416956
CK087_HUMAN	C11orf87	physical	25416956
CJ062_HUMAN	C10orf62	physical	25416956
KRA56_HUMAN	KRTAP5-6	physical	25416956
TYMOS_HUMAN	TYMSOS	physical	25416956
KR411_HUMAN	KRTAP4-11	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.