UniProt ID | PR20E_HUMAN | |
---|---|---|
UniProt AC | P86478 | |
Protein Name | Proline-rich protein 20E | |
Gene Name | PRR20E {ECO:0000312|HGNC:HGNC:37223} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 221 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQGVPVFLTDIAY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | Phosphorylation | QPPARPESPPPAERG CCCCCCCCCCCHHHC | 45.44 | 19413330 | |
195 | Phosphorylation | GFRALGDSAVLQVIQ CHHHCCCCEEEEEEE | 20.62 | 24043423 | |
203 | Phosphorylation | AVLQVIQTPQGTYVQ EEEEEEECCCCCEEC | 13.37 | 24043423 | |
207 | Phosphorylation | VIQTPQGTYVQGVPV EEECCCCCEECCEEE | 18.44 | 24043423 | |
208 | Phosphorylation | IQTPQGTYVQGVPVF EECCCCCEECCEEEE | 9.52 | 24043423 | |
217 | Phosphorylation | QGVPVFLTDIAY--- CCEEEEEEECCC--- | 17.56 | 24043423 | |
221 | Phosphorylation | VFLTDIAY------- EEEEECCC------- | 21.30 | 24043423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PR20E_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PR20E_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PR20E_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PR20E_HUMAN | PRR20A | physical | 25416956 | |
PR20C_HUMAN | PRR20A | physical | 25416956 | |
PR20D_HUMAN | PRR20A | physical | 25416956 | |
PR20B_HUMAN | PRR20A | physical | 25416956 | |
PR20A_HUMAN | PRR20A | physical | 25416956 | |
SELV_HUMAN | SELV | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...