UniProt ID | SELV_HUMAN | |
---|---|---|
UniProt AC | P59797 | |
Protein Name | Selenoprotein V {ECO:0000303|PubMed:27645994} | |
Gene Name | SELENOV {ECO:0000303|PubMed:27645994, ECO:0000312|HGNC:HGNC:30399} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 346 | |
Subcellular Localization | ||
Protein Description | May be involved in a redox-related process.. | |
Protein Sequence | MNNQARTPAPSSARTSTSVRASTPTRTPTPLRTPTPVRTRTPIRTLTPVLTPSPAGTSPLVLTPAPAQIPTLVPTPALARIPRLVPPPAPAWIPTPVPTPVPVRNPTPVPTPARTLTPPVRVPAPAPAQLLAGIRAALPVLDSYLAPALPLDPPPEPAPELPLLPEEDPEPAPSLKLIPSVSSEAGPAPGPLPTRTPLAANSPGPTLDFTFRADPSAIGLADPPIPSPVPSPILGTIPSAISLQNCTETFPSSSENFALDKRVLIRVTYCGLUSYSLRYILLKKSLEQQFPNHLLFEEDRAAQATGEFEVFVNGRLVHSKKRGDGFVNESRLQKIVSVIDEEIKKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MNNQARTPAPSSAR -CCCCCCCCCCCCCC | 27.15 | - | |
11 | Phosphorylation | QARTPAPSSARTSTS CCCCCCCCCCCCCCC | 38.44 | - | |
33 | Phosphorylation | RTPTPLRTPTPVRTR CCCCCCCCCCCCCCC | 38.92 | 28634120 | |
35 | Phosphorylation | PTPLRTPTPVRTRTP CCCCCCCCCCCCCCC | 33.53 | 28634120 | |
41 | Phosphorylation | PTPVRTRTPIRTLTP CCCCCCCCCCCCCCC | 23.58 | 22468782 | |
180 | Phosphorylation | PSLKLIPSVSSEAGP CCCEECCCCCCCCCC | 27.86 | 25693802 | |
182 | Phosphorylation | LKLIPSVSSEAGPAP CEECCCCCCCCCCCC | 27.14 | 25693802 | |
183 | Phosphorylation | KLIPSVSSEAGPAPG EECCCCCCCCCCCCC | 29.34 | 25693802 | |
276 | Phosphorylation | YCGLUSYSLRYILLK ECCCHHHHHHHHHHH | 18.70 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SELV_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SELV_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SELV_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SELV_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...