PR20A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PR20A_HUMAN
• UniProt AC: P86496
• Protein Name: Proline-rich protein 20A
• Gene Name: PRR20A
• Organism: Homo sapiens (Human).
• Sequence Length: 221
• Protein Sequence: MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRRQPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHGEPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPVLTLYPCIGFRALGDSAVLQVIQTPQGTYVQGVPVFLTDIAY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
68	Phosphorylation	QPPARPESPPPAERG CCCCCCCCCCCHHHC	45.44	19413330
195	Phosphorylation	GFRALGDSAVLQVIQ CHHHCCCCEEEEEEE	20.62	24043423
203	Phosphorylation	AVLQVIQTPQGTYVQ EEEEEEECCCCCEEC	13.37	24043423
207	Phosphorylation	VIQTPQGTYVQGVPV EEECCCCCEECCEEE	18.44	24043423
208	Phosphorylation	IQTPQGTYVQGVPVF EECCCCCEECCEEEE	9.52	24043423
217	Phosphorylation	QGVPVFLTDIAY--- CCEEEEEEECCC---	17.56	24043423
221	Phosphorylation	VFLTDIAY------- EEEEECCC-------	21.30	24043423

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PR20A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PR20A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PR20A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PR20E_HUMAN	PRR20A	physical	25416956
PR20C_HUMAN	PRR20A	physical	25416956
PR20D_HUMAN	PRR20A	physical	25416956
PR20B_HUMAN	PRR20A	physical	25416956
PR20A_HUMAN	PRR20A	physical	25416956
SELV_HUMAN	SELV	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.