| UniProt ID | RIPP1_HUMAN | |
|---|---|---|
| UniProt AC | Q0D2K3 | |
| Protein Name | Protein ripply1 | |
| Gene Name | RIPPLY1 {ECO:0000312|HGNC:HGNC:25117} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 151 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Plays a role in somitogenesis. Essential for transcriptional repression of the segmental patterning genes, thus terminating the segmentation program in the presomitic mesoderm, and also required for the maintenance of rostrocaudal polarity in somites (By similarity).. | |
| Protein Sequence | MDSAACAAAATPVPALALALAPDLAQAPLALPGLLSPSCLLSSGQEVNGSERGTCLWRPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRSFDYLYSAGEILLQNFPVQATINLYEDSDSEEEEEDEEQEDEEEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of RIPP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIPP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIPP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIPP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TLE4_HUMAN | TLE4 | physical | 28514442 | |
| TLE2_HUMAN | TLE2 | physical | 28514442 | |
| TLE1_HUMAN | TLE1 | physical | 28514442 | |
| TLE3_HUMAN | TLE3 | physical | 28514442 | |
| AES_HUMAN | AES | physical | 28514442 | |
| CHMP6_HUMAN | CHMP6 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...