RIPP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RIPP1_HUMAN
• UniProt AC: Q0D2K3
• Protein Name: Protein ripply1
• Gene Name: RIPPLY1 {ECO:0000312|HGNC:HGNC:25117}
• Organism: Homo sapiens (Human).
• Sequence Length: 151
• Subcellular Localization: Nucleus .
• Protein Description: Plays a role in somitogenesis. Essential for transcriptional repression of the segmental patterning genes, thus terminating the segmentation program in the presomitic mesoderm, and also required for the maintenance of rostrocaudal polarity in somites (By similarity)..
• Protein Sequence: MDSAACAAAATPVPALALALAPDLAQAPLALPGLLSPSCLLSSGQEVNGSERGTCLWRPWLSSTNDSPRQMRKLVDLAAGGATAAEVTKAESKFHHPVRLFWPKSRSFDYLYSAGEILLQNFPVQATINLYEDSDSEEEEEDEEQEDEEEK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of RIPP1_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RIPP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RIPP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RIPP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TLE4_HUMAN	TLE4	physical	28514442
TLE2_HUMAN	TLE2	physical	28514442
TLE1_HUMAN	TLE1	physical	28514442
TLE3_HUMAN	TLE3	physical	28514442
AES_HUMAN	AES	physical	28514442
CHMP6_HUMAN	CHMP6	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.