UniProt ID | THIOM_HUMAN | |
---|---|---|
UniProt AC | Q99757 | |
Protein Name | Thioredoxin, mitochondrial | |
Gene Name | TXN2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 166 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Important for the control of mitochondrial reactive oxygen species homeostasis, apoptosis regulation and cell viability. Possesses a dithiol-reducing activity.. | |
Protein Sequence | MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
94 | Acetylation | AQWCGPCKILGPRLE CCCCCCCEEHHHHHH | 44.06 | 26051181 | |
102 | Acetylation | ILGPRLEKMVAKQHG EHHHHHHHHHHHHCC | 43.18 | 25953088 | |
102 | Ubiquitination | ILGPRLEKMVAKQHG EHHHHHHHHHHHHCC | 43.18 | 21890473 | |
102 | 2-Hydroxyisobutyrylation | ILGPRLEKMVAKQHG EHHHHHHHHHHHHCC | 43.18 | - | |
106 | 2-Hydroxyisobutyrylation | RLEKMVAKQHGKVVM HHHHHHHHHCCCEEE | 31.27 | - | |
128 | Phosphorylation | HTDLAIEYEVSAVPT CCCEEEEEEECCCCE | 18.60 | 28258704 | |
131 | Phosphorylation | LAIEYEVSAVPTVLA EEEEEEECCCCEEEE | 16.17 | 28258704 | |
133 | Ubiquitination | IEYEVSAVPTVLAMK EEEEECCCCEEEEEC | 2.96 | 21890473 | |
152 | Acetylation | VDKFVGIKDEDQLEA EEEECCCCCHHHHHH | 49.49 | 19608861 | |
152 | Succinylation | VDKFVGIKDEDQLEA EEEECCCCCHHHHHH | 49.49 | - | |
152 | 2-Hydroxyisobutyrylation | VDKFVGIKDEDQLEA EEEECCCCCHHHHHH | 49.49 | - | |
152 | Succinylation | VDKFVGIKDEDQLEA EEEECCCCCHHHHHH | 49.49 | 23954790 | |
162 | 2-Hydroxyisobutyrylation | DQLEAFLKKLIG--- HHHHHHHHHHHC--- | 38.80 | - | |
162 | Acetylation | DQLEAFLKKLIG--- HHHHHHHHHHHC--- | 38.80 | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of THIOM_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of THIOM_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of THIOM_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TOM22_HUMAN | TOMM22 | physical | 22939629 | |
TPM4_HUMAN | TPM4 | physical | 22939629 | |
VIME_HUMAN | VIM | physical | 21988832 | |
GCR_HUMAN | NR3C1 | physical | 19570036 | |
TF65_HUMAN | RELA | physical | 19570036 | |
RABX5_HUMAN | RABGEF1 | physical | 25416956 | |
ATRAP_HUMAN | AGTRAP | physical | 25416956 | |
PACE1_HUMAN | SCYL3 | physical | 25416956 | |
COAC_HUMAN | PPCDC | physical | 25416956 | |
TIFA_HUMAN | TIFA | physical | 25416956 | |
REEP6_HUMAN | REEP6 | physical | 25416956 | |
CC114_HUMAN | CCDC114 | physical | 25416956 | |
MR1L1_HUMAN | MRFAP1L1 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
RBM45_HUMAN | RBM45 | physical | 25416956 | |
FAM9B_HUMAN | FAM9B | physical | 25416956 | |
ANXA6_HUMAN | ANXA6 | physical | 26344197 | |
FA98B_HUMAN | FAM98B | physical | 26344197 | |
SODC_HUMAN | SOD1 | physical | 26344197 | |
THIO_HUMAN | TXN | physical | 26344197 | |
WDR12_HUMAN | WDR12 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-152, AND MASS SPECTROMETRY. |