UniProt ID | FAM9B_HUMAN | |
---|---|---|
UniProt AC | Q8IZU0 | |
Protein Name | Protein FAM9B | |
Gene Name | FAM9B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 186 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MAAWGKKHAGKDPVRDECEERNRFTETREEDVTDEHGEREPFAETDEHTGANTKKPEDTAEDLTAKRKRMKMDKTCSKTKNKSKHALRKKQLKRQKRDYIHSLKLLNVLEEYITDEQKEEEEEEGEEEELIRIFQEQQKKWQQYRSVRRERLKEMKLLRDQFVKALEDFEDLCDRVFSDEDSELDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FAM9B_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FAM9B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FAM9B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FAM9B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FAM9B_HUMAN | FAM9B | physical | 25416956 | |
FER3L_HUMAN | FERD3L | physical | 25416956 | |
BL1S2_HUMAN | BLOC1S2 | physical | 25416956 | |
CE57L_HUMAN | CEP57L1 | physical | 25416956 | |
GSTK1_HUMAN | GSTK1 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...