UniProt ID | BL1S2_HUMAN | |
---|---|---|
UniProt AC | Q6QNY1 | |
Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit 2 | |
Gene Name | BLOC1S2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 142 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Lysosome membrane . Localizes to the centrosomes in a microtubule-dependent manner. | |
Protein Description | Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. [PubMed: 15102850] | |
Protein Sequence | MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAAAEGVL ------CCCHHCCCC | 13.05 | 25944712 | |
11 | Phosphorylation | AAEGVLATRSDEPAR HHCCCCCCCCCCCCC | 26.92 | 24505115 | |
30 | Ubiquitination | VETAEEAKEPAEADI HHCHHHHCCCCCCCH | 68.46 | - | |
63 | Phosphorylation | LTATSEDYKLLENMN CCCCHHHHHHHHHHH | 10.24 | 18083107 | |
64 | Acetylation | TATSEDYKLLENMNK CCCHHHHHHHHHHHH | 59.94 | 19826879 | |
71 | Ubiquitination | KLLENMNKLTSLKYL HHHHHHHHHHCCHHH | 42.23 | - | |
76 | Ubiquitination | MNKLTSLKYLEMKDI HHHHHCCHHHHHHHH | 47.78 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BL1S2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BL1S2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BL1S2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BL1S6_HUMAN | BLOC1S6 | physical | 15102850 | |
BL1S5_HUMAN | BLOC1S5 | physical | 15102850 | |
SNAPN_HUMAN | SNAPIN | physical | 15102850 | |
BL1S1_HUMAN | BLOC1S1 | physical | 15102850 | |
BL1S3_HUMAN | BLOC1S3 | physical | 15102850 | |
BL1S4_HUMAN | BLOC1S4 | physical | 15102850 | |
A4_HUMAN | APP | physical | 21832049 | |
MIPT3_HUMAN | TRAF3IP1 | physical | 27173435 | |
IFT20_HUMAN | IFT20 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |