| UniProt ID | BL1S4_HUMAN | |
|---|---|---|
| UniProt AC | Q9NUP1 | |
| Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit 4 | |
| Gene Name | BLOC1S4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 217 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking.. | |
| Protein Sequence | MEGSFSDGGALPEGLAEEAEPQGAAWSGDSGTVSQSHSSASGPWEDEGAEDGAPGRDLPLLRRAAAGYAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSRIDRLEAFVRMVGGRVARMEEQVTKAEAELGTFPRAFKKLLHTMNVPSLFSKSAPSRPQQAGYEAPVLFRTEDYFPCCSERPQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 88 | Phosphorylation | EVEALDASLEDLLTR HHHHHHCHHHHHHHH | 27251275 | ||
| 133 | Phosphorylation | AEMRRIYSRIDRLEA HHHHHHHHHHHHHHH | 24719451 | ||
| 165 | Phosphorylation | KAEAELGTFPRAFKK HHHHHHCCCHHHHHH | 29255136 | ||
| 176 | Phosphorylation | AFKKLLHTMNVPSLF HHHHHHHHCCCCHHH | - | ||
| 181 | Phosphorylation | LHTMNVPSLFSKSAP HHHCCCCHHHCCCCC | 24425749 | ||
| 184 | Phosphorylation | MNVPSLFSKSAPSRP CCCCHHHCCCCCCCC | 24719451 | ||
| 186 | Phosphorylation | VPSLFSKSAPSRPQQ CCHHHCCCCCCCCHH | 21945579 | ||
| 189 | Phosphorylation | LFSKSAPSRPQQAGY HHCCCCCCCCHHCCC | 21945579 | ||
| 196 | Phosphorylation | SRPQQAGYEAPVLFR CCCHHCCCCCCEEEE | 21945579 | ||
| 204 | Phosphorylation | EAPVLFRTEDYFPCC CCCEEEECCCCCCCC | 26552605 | ||
| 207 | Phosphorylation | VLFRTEDYFPCCSER EEEECCCCCCCCCCC | 26552605 | ||
| 212 | Phosphorylation | EDYFPCCSERPQL-- CCCCCCCCCCCCC-- | 26552605 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BL1S4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BL1S4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BL1S4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BL1S6_HUMAN | BLOC1S6 | physical | 15102850 | |
| SNAPN_HUMAN | SNAPIN | physical | 15102850 | |
| BL1S2_HUMAN | BLOC1S2 | physical | 15102850 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
