UniProt ID | BL1S6_HUMAN | |
---|---|---|
UniProt AC | Q9UL45 | |
Protein Name | Biogenesis of lysosome-related organelles complex 1 subunit 6 | |
Gene Name | BLOC1S6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 172 | |
Subcellular Localization |
Cytoplasm . Membrane Peripheral membrane protein . It can exist as a soluble protein as well as a peripheral membrane protein (PubMed:12019270). |
|
Protein Description | Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. May play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process.. | |
Protein Sequence | MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSVPGPSSP ------CCCCCCCCC | - | ||
7 | Phosphorylation | -MSVPGPSSPDGALT -CCCCCCCCCCCCCC | 28348404 | ||
8 | Phosphorylation | MSVPGPSSPDGALTR CCCCCCCCCCCCCCC | 28348404 | ||
14 | Phosphorylation | SSPDGALTRPPYCLE CCCCCCCCCCCEECC | 27251275 | ||
30 | Phosphorylation | GEPTPGLSDTSPDEG CCCCCCCCCCCCCCC | 27251275 | ||
32 | Phosphorylation | PTPGLSDTSPDEGLI CCCCCCCCCCCCCCC | 27251275 | ||
33 | Phosphorylation | TPGLSDTSPDEGLIE CCCCCCCCCCCCCCC | 27251275 | ||
68 | Ubiquitination | LPDLQRSKQALQELT CHHHHHHHHHHHHHH | - | ||
138 | Acetylation | KLKKRALKLQQKRQK HHHHHHHHHHHHHHH | 25953088 | ||
138 | Ubiquitination | KLKKRALKLQQKRQK HHHHHHHHHHHHHHH | - | ||
145 | Acetylation | KLQQKRQKEELEREQ HHHHHHHHHHHHHHH | 11717463 | ||
162 | Ubiquitination | EKEFEREKQLTARPA HHHHHHHHHHHCCCC | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BL1S6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BL1S6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BL1S6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
WASC3_HUMAN | CCDC53 | physical | 16189514 | |
SKA1_HUMAN | SKA1 | physical | 16189514 | |
PKHF2_HUMAN | PLEKHF2 | physical | 16189514 | |
BL1S6_HUMAN | BLOC1S6 | physical | 16189514 | |
EXOC8_HUMAN | EXOC8 | physical | 16189514 | |
LURA1_HUMAN | LURAP1 | physical | 16189514 | |
NTAQ1_HUMAN | WDYHV1 | physical | 16189514 | |
AGGF1_HUMAN | AGGF1 | physical | 16189514 | |
SNAPN_HUMAN | SNAPIN | physical | 15102850 | |
BL1S1_HUMAN | BLOC1S1 | physical | 15102850 | |
BL1S2_HUMAN | BLOC1S2 | physical | 15102850 | |
BL1S3_HUMAN | BLOC1S3 | physical | 15102850 | |
DTBP1_HUMAN | DTNBP1 | physical | 15102850 | |
BL1S5_HUMAN | BLOC1S5 | physical | 15102850 | |
BL1S6_HUMAN | BLOC1S6 | physical | 15102850 | |
BL1S4_HUMAN | BLOC1S4 | physical | 15102850 | |
BL1S5_HUMAN | BLOC1S5 | physical | 12019270 | |
STX12_HUMAN | STX12 | physical | 10610180 | |
A4_HUMAN | APP | physical | 21832049 | |
BL1S6_HUMAN | BLOC1S6 | physical | 25416956 | |
RABX5_HUMAN | RABGEF1 | physical | 25416956 | |
CCHCR_HUMAN | CCHCR1 | physical | 25416956 | |
CC136_HUMAN | CCDC136 | physical | 25416956 | |
CORO6_HUMAN | CORO6 | physical | 25416956 | |
HAUS1_HUMAN | HAUS1 | physical | 25416956 | |
SKA1_HUMAN | SKA1 | physical | 25416956 | |
SYCE3_HUMAN | SYCE3 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...