UniProt ID | SKA1_HUMAN | |
---|---|---|
UniProt AC | Q96BD8 | |
Protein Name | Spindle and kinetochore-associated protein 1 | |
Gene Name | SKA1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 255 | |
Subcellular Localization | Cytoplasm, cytoskeleton, spindle . Chromosome, centromere, kinetochore . Localizes to the outer kinetochore and spindle microtubules during mitosis in a NDC80 complex-dependent manner (PubMed:17093495). Localizes to both the mitotic spindle and kinet | |
Protein Description | Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. [PubMed: 17093495] | |
Protein Sequence | MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MASSDLEQL ------CCCHHHHHH | 20.10 | 19413330 | |
4 | Phosphorylation | ----MASSDLEQLCS ----CCCHHHHHHHH | 36.35 | - | |
11 | Phosphorylation | SDLEQLCSHVNEKIG HHHHHHHHHHHHHHC | 38.78 | - | |
25 | Phosphorylation | GNIKKTLSLRNCGQE CHHHHHHCCCCCCCC | 30.43 | 25159151 | |
36 | Ubiquitination | CGQEPTLKTVLNKIG CCCCCCHHHHHHHHC | 38.78 | - | |
76 | Phosphorylation | SLKELCESLEEDYKD HHHHHHHHHHHHHHH | 39.83 | 25159151 | |
81 | Phosphorylation | CESLEEDYKDIEHLK HHHHHHHHHHHHHHH | 17.53 | 28796482 | |
117 | Ubiquitination | LDPEEPIKVEEPEPV CCCCCCCCCCCCCCC | 55.07 | - | |
117 | Sumoylation | LDPEEPIKVEEPEPV CCCCCCCCCCCCCCC | 55.07 | - | |
117 | Sumoylation | LDPEEPIKVEEPEPV CCCCCCCCCCCCCCC | 55.07 | - | |
135 | Ubiquitination | PKEQRSIKEMPFITC CHHHCCCCCCCCEEE | 49.56 | - | |
153 | Ubiquitination | NGVPSYMKSRLTYNQ CCCCHHHHHCCCHHH | 24.96 | - | |
157 | Phosphorylation | SYMKSRLTYNQINDV HHHHHCCCHHHHHHH | 21.22 | 18491316 | |
158 | Phosphorylation | YMKSRLTYNQINDVI HHHHCCCHHHHHHHH | 15.06 | 29496907 | |
166 | Ubiquitination | NQINDVIKEINKAVI HHHHHHHHHHHHHHH | 53.00 | - | |
170 | Ubiquitination | DVIKEINKAVISKYK HHHHHHHHHHHHHHH | 50.09 | - | |
175 | Ubiquitination | INKAVISKYKILHQP HHHHHHHHHHHHCCC | 39.16 | - | |
176 | Phosphorylation | NKAVISKYKILHQPK HHHHHHHHHHHCCCC | 9.11 | - | |
177 | Ubiquitination | KAVISKYKILHQPKK HHHHHHHHHHCCCCC | 42.39 | - | |
183 | Ubiquitination | YKILHQPKKSMNSVT HHHHCCCCCCCCHHH | 51.41 | - | |
184 | Ubiquitination | KILHQPKKSMNSVTR HHHCCCCCCCCHHHH | 62.71 | - | |
185 | Phosphorylation | ILHQPKKSMNSVTRN HHCCCCCCCCHHHHH | 29.35 | 21406692 | |
188 | Phosphorylation | QPKKSMNSVTRNLYH CCCCCCCHHHHHHHH | 19.07 | 21406692 | |
190 | Phosphorylation | KKSMNSVTRNLYHRF CCCCCHHHHHHHHHH | 17.41 | 21406692 | |
194 | Phosphorylation | NSVTRNLYHRFIDEE CHHHHHHHHHHCCCC | 8.42 | 29759185 | |
202 | Phosphorylation | HRFIDEETKDTKGRY HHHCCCCCCCCCCCE | 31.97 | 29759185 | |
203 | Ubiquitination | RFIDEETKDTKGRYF HHCCCCCCCCCCCEE | 67.68 | - | |
205 | Phosphorylation | IDEETKDTKGRYFIV CCCCCCCCCCCEEEE | 36.63 | 29759185 | |
206 | Ubiquitination | DEETKDTKGRYFIVE CCCCCCCCCCEEEEE | 52.07 | - | |
242 | Phosphorylation | LRHCRRLSEVRGGGL HHHHHHHHHHCCCCC | 32.03 | 20860994 | |
245 | Methylation | CRRLSEVRGGGLTRY HHHHHHHCCCCCCEE | 33.71 | 115917013 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SKA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SKA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SKA1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |