UniProt ID | SPC24_HUMAN | |
---|---|---|
UniProt AC | Q8NBT2 | |
Protein Name | Kinetochore protein Spc24 | |
Gene Name | SPC24 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 197 | |
Subcellular Localization | Nucleus . Chromosome, centromere, kinetochore . Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore. | |
Protein Description | Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. [PubMed: 14738735 Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore] | |
Protein Sequence | MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAKEQVHQGGVELQQLEAGLQEAGEEDTRLKASLLYLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVAQLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | FRDIEEVSQGLLSLL CCCHHHHHHHHHHHH | 23.08 | 20873877 | |
16 | Phosphorylation | EVSQGLLSLLGANRA HHHHHHHHHHCCCHH | 26.96 | 20873877 | |
50 | Acetylation | ETQDGAEKQLREILT HCCCHHHHHHHHHHH | 54.84 | 23236377 | |
50 | Ubiquitination | ETQDGAEKQLREILT HCCCHHHHHHHHHHH | 54.84 | 21890473 | |
50 | Ubiquitination | ETQDGAEKQLREILT HCCCHHHHHHHHHHH | 54.84 | 21890473 | |
50 | Ubiquitination | ETQDGAEKQLREILT HCCCHHHHHHHHHHH | 54.84 | 21890473 | |
60 | Ubiquitination | REILTMEKEVAQSLL HHHHHHHHHHHHHHH | 46.82 | - | |
65 | Phosphorylation | MEKEVAQSLLNAKEQ HHHHHHHHHHHHHHH | 25.70 | 28555341 | |
70 | Ubiquitination | AQSLLNAKEQVHQGG HHHHHHHHHHHHHCC | 47.83 | 21890473 | |
98 | Ubiquitination | GEEDTRLKASLLYLT CCCCHHHHHHHHHHH | 32.41 | - | |
105 | Phosphorylation | KASLLYLTRELEELK HHHHHHHHHHHHHHH | 14.45 | 20068231 | |
112 | Ubiquitination | TRELEELKEIEADLE HHHHHHHHHHHHHHH | 60.98 | 2190698 | |
123 | Ubiquitination | ADLERQEKEVDEDTT HHHHHHHHCCCCCCC | 55.49 | - | |
129 | Phosphorylation | EKEVDEDTTVTIPSA HHCCCCCCCCCCCHH | 22.55 | 20860994 | |
130 | Phosphorylation | KEVDEDTTVTIPSAV HCCCCCCCCCCCHHH | 28.15 | 25159151 | |
138 | Phosphorylation | VTIPSAVYVAQLYHQ CCCCHHHHHHHHHHH | 6.98 | - | |
143 | Phosphorylation | AVYVAQLYHQVSKIE HHHHHHHHHHHHCCC | 4.33 | - | |
161 | Ubiquitination | ECEPGMVKGIHHGPS CCCCCCCCEECCCCC | 43.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPC24_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPC24_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPC24_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-11, AND MASSSPECTROMETRY. | |
"Phosphoproteome analysis of the human mitotic spindle."; Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R.; Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-130, AND MASSSPECTROMETRY. |