| UniProt ID | LURA1_HUMAN | |
|---|---|---|
| UniProt AC | Q96LR2 | |
| Protein Name | Leucine rich adaptor protein 1 | |
| Gene Name | LURAP1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 239 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Acts as an activator of the canonical NF-kappa-B pathway and drive the production of proinflammatory cytokines. Promotes the antigen (Ag)-presenting and priming function of dendritic cells via the canonical NF-kappa-B pathway. [PubMed: 21048106 In concert with MYO18A and CDC42BPA/CDC42BPB, is involved in modulating lamellar actomyosin retrograde flow that is crucial to cell protrusion and migration. Activates CDC42BPA/CDC42BPB and targets it to actomyosin through its interaction with MYO18A, leading to MYL9/MLC2 phosphorylation and MYH9/MYH10-dependent actomyosin assembly in the lamella (By similarity] | |
| Protein Sequence | MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 115 | Phosphorylation | TSSQYSLTGGSPGRS CCCCCCCCCCCCCCC | 33.29 | 23312004 | |
| 118 | Phosphorylation | QYSLTGGSPGRSRRG CCCCCCCCCCCCCCC | 26.06 | 24076635 | |
| 126 | Phosphorylation | PGRSRRGSWDSLPDT CCCCCCCCCCCCCCC | 26.37 | 23927012 | |
| 129 | Phosphorylation | SRRGSWDSLPDTSTT CCCCCCCCCCCCCCC | 35.23 | 23927012 | |
| 133 | Phosphorylation | SWDSLPDTSTTDRLD CCCCCCCCCCCCCCC | 26.49 | 27251275 | |
| 134 | Phosphorylation | WDSLPDTSTTDRLDS CCCCCCCCCCCCCCC | 36.37 | 22468782 | |
| 135 | Phosphorylation | DSLPDTSTTDRLDSV CCCCCCCCCCCCCCC | 34.50 | 27251275 | |
| 136 | Phosphorylation | SLPDTSTTDRLDSVS CCCCCCCCCCCCCCC | 20.91 | 27251275 | |
| 141 | Phosphorylation | STTDRLDSVSIGSFL CCCCCCCCCCHHHHH | 23.50 | 27251275 | |
| 143 | Phosphorylation | TDRLDSVSIGSFLDT CCCCCCCCHHHHHHH | 25.78 | 27251275 | |
| 194 | Phosphorylation | VAATRLGSLRAVWKP HHHHHCCCCEEEECC | 21.19 | 24719451 | |
| 213 | Phosphorylation | LQGGPPESPEDESAK CCCCCCCCCCHHHHH | 39.09 | 29255136 | |
| 218 | Phosphorylation | PESPEDESAKLGFEA CCCCCHHHHHCCCEE | 42.92 | 29255136 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LURA1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LURA1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LURA1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of LURA1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-213, AND MASSSPECTROMETRY. | |
